| AgACC | Ag003483 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | CASP8 |
| Common Name | Caspase-8 |
| Full Name | Caspase-8 precursor |
| Synonym | Apototic cysteine protease; Apoptotic protease Mch-5; FADD-homologous ICE/CED-3-like protease; FADD-like YCE; H.sapeins mRNA for MACH-alpha-2 protein; ICE-like apoptotic protease 5; MACH-alpha1/2/3 protein; MACH-beta-1/2/3/4 protein MORT1-associated CED-3 homolog; Mch5 isoform alpha; caspase 8; apoptosis-related cysteine peptidase; apoptotic-related cysteine protease; CAP4; CASP8; CASP-8; EC 3.4.22.-; FLICE; MACH; MCH5; MGC78473; procaspase-8
another display format
- Apototic cysteine protease
- Apoptotic protease Mch-5
- FADD-homologous ICE/CED-3-like protease
- FADD-like YCE
- H.sapeins mRNA for MACH-alpha-2 protein
- ICE-like apoptotic protease 5
- MACH-alpha1/2/3 protein
- MACH-beta-1/2/3/4 protein MORT1-associated CED-3 homolog
- Mch5 isoform alpha
- caspase 8
- apoptosis-related cysteine peptidase
- apoptotic-related cysteine protease
- CAP4
- CASP8
- CASP-8
- EC 3.4.22.-
- FLICE
- MACH
- MCH5
- MGC78473
- procaspase-8
|
| UniProt ID | Q14790
|
| NCBI Gene ID | 841 |
| GeneCard ID | GC02P201233 |
| SwissProt VARIANT ID | VAR_014204 |
| Comment | Caspase-8 deficiency (CASP8D) - Defects in CASP8 are the cause of caspase-8 deficiency (CASP8D). CASP8D is a disorder resembling autoimmune lymphoproliferative syndrome (ALPS). It is characterized by lymphadenopathy, splenomegaly, and defective CD95-induced apoptosis of peripheral blood lymphocytes (PBLs). It leads to defects in activation of T-lymphocytes, B-lymphocytes, and natural killer cells leading to immunodeficiency characterized by recurrent sinopulmonary and herpes simplex virus infections and poor responses to immunization |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000062, Ag000063, Ag000064, Ag000065, Ag000066, Ag000067, Ag000068, Ag000069, Ag000070, Ag001786, Ag001787
Alignment of all Isoforms |
| Mutation entries | Ag000543, Ag000544, Ag003482, Ag003483, Ag003484
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | MKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAG |
| Antigen sequence | MKSKPRGYCLIINNHNFAKAWEKVPKLHSIRDRNGTHLDAG |