| AgACC | Ag004209 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | PAX3 |
| Full Name | Paired box protein Pax-3 |
| Synonym | PAX3/FKHR fusion; paired box gene 3; paired box gene 3 (Waardenburg syndrome 1); paired box homeotic gene 3; paired box homeotic gene 3 (Waardenburg syndrome 1); paired domain gene 3; paired domain gene HuP2; CDHS; HUP2; MGC120381; MGC120382; MGC120383; MGC120384; MGC134778; WS1
another display format
- PAX3/FKHR fusion
- paired box gene 3
- paired box gene 3 (Waardenburg syndrome 1)
- paired box homeotic gene 3
- paired box homeotic gene 3 (Waardenburg syndrome 1)
- paired domain gene 3
- paired domain gene HuP2
- CDHS
- HUP2
- MGC120381
- MGC120382
- MGC120383
- MGC120384
- MGC134778
- WS1
|
| UniProt ID | P23760
|
| NCBI Gene ID | 5077 |
| GeneCard ID | GC02M222199 |
| SwissProt VARIANT ID | VAR_003807 |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000534, Ag000535, Ag000536, Ag002152, Ag002153, Ag002154, Ag002155
Alignment of all Isoforms |
| Mutation entries | Ag004184, Ag004185, Ag004186, Ag004187, Ag004188, Ag004189, Ag004190, Ag004191, Ag004192, Ag004193, Ag004194, Ag004195, Ag004196, Ag004197, Ag004198, Ag004199, Ag004200, Ag004201, Ag004202, Ag004203, Ag004204, Ag004205, Ag004206, Ag004207, Ag004208, Ag004209, Ag004210
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | PPTAMPTLPTYQLSETSYQPTSIPQAVSDPSSTVHRPQPLP |
| Antigen sequence | PPTAMPTLPTYQLSETSYQPKSIPQAVSDPSSTVHRPQPLP |
|