Antigen Record Ag000535

AgACCAg000535
Date01-23-2008
Last updated14-12-2016
Antigen NamePAX3
Full NamePaired box protein Pax-3
SynonymPAX3/FKHR fusion; paired box gene 3; paired box gene 3 (Waardenburg syndrome 1); paired box homeotic gene 3; paired box homeotic gene 3 (Waardenburg syndrome 1); paired domain gene 3; paired domain gene HuP2; CDHS; HUP2; MGC120381; MGC120382; MGC120383; MGC120384; MGC134778; WS1

another display format
  • PAX3/FKHR fusion
  • paired box gene 3
  • paired box gene 3 (Waardenburg syndrome 1)
  • paired box homeotic gene 3
  • paired box homeotic gene 3 (Waardenburg syndrome 1)
  • paired domain gene 3
  • paired domain gene HuP2
  • CDHS
  • HUP2
  • MGC120381
  • MGC120382
  • MGC120383
  • MGC120384
  • MGC134778
  • WS1
UniProt IDP23760
NCBI Gene ID5077
GeneCard IDGC02M222199
CommentThis is a splice isoform.
AnnotationThis is a full length sequence.
IsoformsAg000534,  Ag000536,  Ag002152,  Ag002153,  Ag002154,  Ag002155

Alignment of all Isoforms
Mutation entriesAg004184,  Ag004185,  Ag004186,  Ag004187,  Ag004188,  Ag004189,  Ag004190,  Ag004191,  Ag004192,  Ag004193,  Ag004194,  Ag004195,  Ag004196,  Ag004197,  Ag004198,  Ag004199,  Ag004200,  Ag004201,  Ag004202,  Ag004203,  Ag004204,  Ag004205,  Ag004206,  Ag004207,  Ag004208,  Ag004209,  Ag004210

View mutation map
RNA/protein expression profileRNA and protein Expression profile
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPC
VISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKD
AVCDRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERGKRWRLGRRTCWVTW
RASAS