| AgACC | Ag004186 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | PAX3 |
| Full Name | Paired box protein Pax-3 |
| Synonym | PAX3/FKHR fusion; paired box gene 3; paired box gene 3 (Waardenburg syndrome 1); paired box homeotic gene 3; paired box homeotic gene 3 (Waardenburg syndrome 1); paired domain gene 3; paired domain gene HuP2; CDHS; HUP2; MGC120381; MGC120382; MGC120383; MGC120384; MGC134778; WS1
another display format
- PAX3/FKHR fusion
- paired box gene 3
- paired box gene 3 (Waardenburg syndrome 1)
- paired box homeotic gene 3
- paired box homeotic gene 3 (Waardenburg syndrome 1)
- paired domain gene 3
- paired domain gene HuP2
- CDHS
- HUP2
- MGC120381
- MGC120382
- MGC120383
- MGC120384
- MGC134778
- WS1
|
| UniProt ID | P23760
|
| NCBI Gene ID | 5077 |
| GeneCard ID | GC02M222199 |
| SwissProt VARIANT ID | VAR_003792 |
| Comment | Craniofacial-deafness-hand syndrome (CDHS) - Defects in PAX3 are the cause of craniofacial-deafness-hand syndrome. CDHS is thought to be an autosomal dominant disease which comprises absence or hypoplasia of the nasal bones, hypoplastic maxilla, small and short nose with thin nares, limited movement of the wrist, short palpebral fissures, ulnar deviation of the fingers, hypertelorism and profound sensory-neural deafness |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000534, Ag000535, Ag000536, Ag002152, Ag002153, Ag002154, Ag002155
Alignment of all Isoforms |
| Mutation entries | Ag004184, Ag004185, Ag004186, Ag004187, Ag004188, Ag004189, Ag004190, Ag004191, Ag004192, Ag004193, Ag004194, Ag004195, Ag004196, Ag004197, Ag004198, Ag004199, Ag004200, Ag004201, Ag004202, Ag004203, Ag004204, Ag004205, Ag004206, Ag004207, Ag004208, Ag004209, Ag004210
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | LEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGI |
| Antigen sequence | LEVSTPLGQGRVNQLGGVFIKGRPLPNHIRHKIVEMAHHGI |
|