Antigen Record Ag000536

AgACCAg000536
Date01-23-2008
Last updated14-12-2016
Antigen NamePAX3
Full NamePaired box protein Pax-3
SynonymPAX3/FKHR fusion; paired box gene 3; paired box gene 3 (Waardenburg syndrome 1); paired box homeotic gene 3; paired box homeotic gene 3 (Waardenburg syndrome 1); paired domain gene 3; paired domain gene HuP2; CDHS; HUP2; MGC120381; MGC120382; MGC120383; MGC120384; MGC134778; WS1

another display format
  • PAX3/FKHR fusion
  • paired box gene 3
  • paired box gene 3 (Waardenburg syndrome 1)
  • paired box homeotic gene 3
  • paired box homeotic gene 3 (Waardenburg syndrome 1)
  • paired domain gene 3
  • paired domain gene HuP2
  • CDHS
  • HUP2
  • MGC120381
  • MGC120382
  • MGC120383
  • MGC120384
  • MGC134778
  • WS1
UniProt IDP23760
NCBI Gene ID5077
GeneCard IDGC02M222199
CommentThis is a splice isoform.
AnnotationThis is a full length sequence.
IsoformsAg000534Ag000535Ag002152Ag002153Ag002154Ag002155

Alignment of all Isoforms
Mutation entriesAg004184Ag004185Ag004186Ag004187Ag004188Ag004189Ag004190Ag004191Ag004192Ag004193Ag004194Ag004195Ag004196Ag004197Ag004198Ag004199Ag004200Ag004201Ag004202Ag004203Ag004204Ag004205Ag004206Ag004207Ag004208Ag004209Ag004210

View mutation map
RNA/protein expression profileRNA and protein Expression profile
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPC
VISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKD
AVCDRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERGKALVSGVSSH