| AgACC | Ag004089 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | APC |
| Full Name | Adenomatosis polyposis coli |
| Synonym | DP2; DP2.5; DP3; FAP; FPC; GS; Adenomatous polyposis coli protein; Protein APC; adenomatosis polyposis coli; adenomatosis polyposis coli tumor suppressor
another display format
- DP2
- DP2.5
- DP3
- FAP
- FPC
- GS
- Adenomatous polyposis coli protein
- Protein APC
- adenomatosis polyposis coli
- adenomatosis polyposis coli tumor suppressor
|
| UniProt ID | P25054
|
| NCBI Gene ID | 324 |
| GeneCard ID | GC05P112707 |
| SwissProt VARIANT ID | VAR_008994 |
| Comment | Familial adenomatous polyposis (FAP) - Defects in APC are a cause of familial adenomatous polyposis; which includes also Gardner syndrome (GS). FAP and GS contribute to tumor development in patients with uninherited forms of colorectal cancer. FAP is characterized by adenomatous polyps of the colon and rectum, but also of upper gastrointestinal tract (ampullary, duodenal and gastric adenomas). This is a viciously premalignant disease with one or more polyps progressing through dysplasia to malignancy in untreated gene carriers with a median age at diagnosis of 40 years |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000432, Ag000433
Alignment of all Isoforms |
| Mutation entries | Ag000656, Ag000657, Ag000658, Ag000659, Ag000660, Ag000661, Ag000662, Ag000663, Ag000664, Ag000665, Ag000666, Ag000667, Ag000668, Ag000669, Ag000670, Ag000671 ... Display all entries
Ag000673, Ag000674, Ag000675, Ag000676, Ag000677, Ag000678, Ag000679, Ag000680, Ag000681, Ag000682, Ag000683, Ag000684, Ag000685, Ag000686, Ag000687, Ag000688, Ag000689, Ag000690, Ag000691, Ag000692, Ag000693, Ag000694, Ag000695, Ag000696, Ag000697, Ag000698, Ag000699, Ag000700, Ag000701, Ag000702, Ag000703, Ag000704, Ag000705, Ag000706, Ag000707, Ag000708, Ag000709, Ag000710, Ag000711, Ag000712, Ag000713, Ag000714, Ag000715, Ag000716, Ag000717, Ag000718, Ag000719, Ag000720, Ag000721, Ag000722, Ag000723, Ag000724, Ag000725, Ag000726, Ag000727, Ag000728, Ag000729, Ag000730, Ag000731, Ag000732, Ag000733, Ag000734, Ag000735, Ag000736, Ag000737, Ag004069, Ag004070, Ag004071, Ag004072, Ag004073, Ag004074, Ag004075, Ag004076, Ag004077, Ag004078, Ag004079, Ag004080, Ag004081, Ag004082, Ag004083, Ag004084, Ag004085, Ag004086, Ag004087, Ag004088, Ag004089, Ag004090
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | LENRLNSFIQVDAPDQKGTEIKPGQNNPVPVSETNESSIVE |
| Antigen sequence | LENRLNSFIQVDAPDQKGTETKPGQNNPVPVSETNESSIVE |
|