| AgACC | Ag000662 |
| Date | 29-03-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | APC |
| Full Name | Adenomatosis polyposis coli |
| Synonym | DP2; DP2.5; DP3; FAP; FPC; GS; Adenomatous polyposis coli protein; Protein APC; adenomatosis polyposis coli; adenomatosis polyposis coli tumor suppressor
another display format
- DP2
- DP2.5
- DP3
- FAP
- FPC
- GS
- Adenomatous polyposis coli protein
- Protein APC
- adenomatosis polyposis coli
- adenomatosis polyposis coli tumor suppressor
|
| UniProt ID | P25054
|
| NCBI Gene ID | 324 |
| GeneCard ID | GC05P112707 |
| COSMIC ID | 18716
|
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000432, Ag000433
Alignment of all Isoforms |
| Mutation entries | Ag000656, Ag000657, Ag000658, Ag000659, Ag000660, Ag000661, Ag000662, Ag000663, Ag000664, Ag000665, Ag000666, Ag000667, Ag000668, Ag000669, Ag000670, Ag000671 ... Display all entries
Ag000673, Ag000674, Ag000675, Ag000676, Ag000677, Ag000678, Ag000679, Ag000680, Ag000681, Ag000682, Ag000683, Ag000684, Ag000685, Ag000686, Ag000687, Ag000688, Ag000689, Ag000690, Ag000691, Ag000692, Ag000693, Ag000694, Ag000695, Ag000696, Ag000697, Ag000698, Ag000699, Ag000700, Ag000701, Ag000702, Ag000703, Ag000704, Ag000705, Ag000706, Ag000707, Ag000708, Ag000709, Ag000710, Ag000711, Ag000712, Ag000713, Ag000714, Ag000715, Ag000716, Ag000717, Ag000718, Ag000719, Ag000720, Ag000721, Ag000722, Ag000723, Ag000724, Ag000725, Ag000726, Ag000727, Ag000728, Ag000729, Ag000730, Ag000731, Ag000732, Ag000733, Ag000734, Ag000735, Ag000736, Ag000737, Ag004069, Ag004070, Ag004071, Ag004072, Ag004073, Ag004074, Ag004075, Ag004076, Ag004077, Ag004078, Ag004079, Ag004080, Ag004081, Ag004082, Ag004083, Ag004084, Ag004085, Ag004086, Ag004087, Ag004088, Ag004089, Ag004090
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | QICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEM |
| Antigen sequence | QICPAVCVLMKLSFDEEHRHSMNELGGLQAIAELLQVDCEM |
|