| AgACC | Ag003831 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | TGFBR2 |
| Common Name | TGF-beta receptor type IIB |
| Full Name | TGF-beta receptor type II |
| Synonym | TGF-beta receptor type IIB; TGF-beta receptor type-2 precursor; TGF-beta type II receptor; Transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70-80kD); transforming growth factor, beta receptor II (70/80kDa); AAT3; EC 2.7.11.30; FAA3; HNPCC6; MFS2; RIIC 2; TAAD2; TGFR-2; TGFBR2; TGFbeta-RII; TbetaR-II
another display format
- TGF-beta receptor type IIB
- TGF-beta receptor type-2 precursor
- TGF-beta type II receptor
- Transforming growth factor-beta receptor type II
- transforming growth factor beta receptor type IIC
- transforming growth factor, beta receptor II
- transforming growth factor, beta receptor II (70-80kD)
- transforming growth factor, beta receptor II (70/80kDa)
- AAT3
- EC 2.7.11.30
- FAA3
- HNPCC6
- MFS2
- RIIC 2
- TAAD2
- TGFR-2
- TGFBR2
- TGFbeta-RII
- TbetaR-II
|
| UniProt ID | P37173
|
| NCBI Gene ID | 7048 |
| GeneCard ID | GC03P030623 |
| SwissProt VARIANT ID | VAR_029760 |
| Comment | Aortic aneurysm familial thoracic type 3 (AAT3) - Defects in TGFBR2 are the cause of aortic aneurysm familial thoracic type 3. Aneurysms and dissections of the aorta usually result from degenerative changes in the aortic wall. Thoracic aortic aneurysms and dissections are primarily associated with a characteristic histologic appearance known as 'medial necrosis' or 'Erdheim cystic medial necrosis' in which there is degeneration and fragmentation of elastic fibers, loss of smooth muscle cells, and an accumulation of basophilic ground substance. AAT3 is an autosomal dominant disorder with reduced penetrance and variable expression |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000303, Ag000304
Alignment of all Isoforms |
| Mutation entries | Ag000564, Ag000565, Ag000566, Ag003816, Ag003817, Ag003818, Ag003819, Ag003820, Ag003821, Ag003822, Ag003823, Ag003824, Ag003825, Ag003826, Ag003827, Ag003828, Ag003829, Ag003830, Ag003831, Ag003832, Ag003833, Ag003834, Ag003835, Ag003836
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | ESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE |
| Antigen sequence | ESFKQTDVYSMALVLWEMTSCCNAVGEVKDYEPPFGSKVRE |
|