| AgACC | Ag003828 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | TGFBR2 |
| Common Name | TGF-beta receptor type IIB |
| Full Name | TGF-beta receptor type II |
| Synonym | TGF-beta receptor type IIB; TGF-beta receptor type-2 precursor; TGF-beta type II receptor; Transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70-80kD); transforming growth factor, beta receptor II (70/80kDa); AAT3; EC 2.7.11.30; FAA3; HNPCC6; MFS2; RIIC 2; TAAD2; TGFR-2; TGFBR2; TGFbeta-RII; TbetaR-II
another display format
- TGF-beta receptor type IIB
- TGF-beta receptor type-2 precursor
- TGF-beta type II receptor
- Transforming growth factor-beta receptor type II
- transforming growth factor beta receptor type IIC
- transforming growth factor, beta receptor II
- transforming growth factor, beta receptor II (70-80kD)
- transforming growth factor, beta receptor II (70/80kDa)
- AAT3
- EC 2.7.11.30
- FAA3
- HNPCC6
- MFS2
- RIIC 2
- TAAD2
- TGFR-2
- TGFBR2
- TGFbeta-RII
- TbetaR-II
|
| UniProt ID | P37173
|
| NCBI Gene ID | 7048 |
| GeneCard ID | GC03P030623 |
| SwissProt VARIANT ID | VAR_022357 |
| Comment | A breast tumor; Signaling of TGF-beta significantly inhibited |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000303, Ag000304
Alignment of all Isoforms |
| Mutation entries | Ag000564, Ag000565, Ag000566, Ag003816, Ag003817, Ag003818, Ag003819, Ag003820, Ag003821, Ag003822, Ag003823, Ag003824, Ag003825, Ag003826, Ag003827, Ag003828, Ag003829, Ag003830, Ag003831, Ag003832, Ag003833, Ag003834, Ag003835, Ag003836
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | PEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEV |
| Antigen sequence | PEVLESRMNLENVESFKQTDAYSMALVLWEMTSRCNAVGEV |
|