| AgACC | Ag003821 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | TGFBR2 |
| Common Name | TGF-beta receptor type IIB |
| Full Name | TGF-beta receptor type II |
| Synonym | TGF-beta receptor type IIB; TGF-beta receptor type-2 precursor; TGF-beta type II receptor; Transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70-80kD); transforming growth factor, beta receptor II (70/80kDa); AAT3; EC 2.7.11.30; FAA3; HNPCC6; MFS2; RIIC 2; TAAD2; TGFR-2; TGFBR2; TGFbeta-RII; TbetaR-II
another display format
- TGF-beta receptor type IIB
- TGF-beta receptor type-2 precursor
- TGF-beta type II receptor
- Transforming growth factor-beta receptor type II
- transforming growth factor beta receptor type IIC
- transforming growth factor, beta receptor II
- transforming growth factor, beta receptor II (70-80kD)
- transforming growth factor, beta receptor II (70/80kDa)
- AAT3
- EC 2.7.11.30
- FAA3
- HNPCC6
- MFS2
- RIIC 2
- TAAD2
- TGFR-2
- TGFBR2
- TGFbeta-RII
- TbetaR-II
|
| UniProt ID | P37173
|
| NCBI Gene ID | 7048 |
| GeneCard ID | GC03P030623 |
| SwissProt VARIANT ID | VAR_022352 |
| Comment | Loeys-Dietz syndrome type 1B (LDS1B) - Defects in TGFBR2 are the cause of Loeys-Dietz syndrome type 1B. LDS1 is an aortic aneurysm syndrome with widespread systemic involvement. The disorder is characterized by arterial tortuosity and aneurysms, craniosynostosis, hypertelorism, and bifid uvula or cleft palate. Other findings include exotropy, micrognathia and retrognathia, structural brain abnormalities, intellectual deficit, congenital heart disease, translucent skin, joint hyperlaxity and aneurysm with dissection throughout the arterial tree |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000303, Ag000304
Alignment of all Isoforms |
| Mutation entries | Ag000564, Ag000565, Ag000566, Ag003816, Ag003817, Ag003818, Ag003819, Ag003820, Ag003821, Ag003822, Ag003823, Ag003824, Ag003825, Ag003826, Ag003827, Ag003828, Ag003829, Ag003830, Ag003831, Ag003832, Ag003833, Ag003834, Ag003835, Ag003836
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | ELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLAR |
| Antigen sequence | ELGKQYWLITAFHAKGNLQENLTRHVISWEDLRKLGSSLAR |
|