| AgACC | Ag003819 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | TGFBR2 |
| Common Name | TGF-beta receptor type IIB |
| Full Name | TGF-beta receptor type II |
| Synonym | TGF-beta receptor type IIB; TGF-beta receptor type-2 precursor; TGF-beta type II receptor; Transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70-80kD); transforming growth factor, beta receptor II (70/80kDa); AAT3; EC 2.7.11.30; FAA3; HNPCC6; MFS2; RIIC 2; TAAD2; TGFR-2; TGFBR2; TGFbeta-RII; TbetaR-II
another display format
- TGF-beta receptor type IIB
- TGF-beta receptor type-2 precursor
- TGF-beta type II receptor
- Transforming growth factor-beta receptor type II
- transforming growth factor beta receptor type IIC
- transforming growth factor, beta receptor II
- transforming growth factor, beta receptor II (70-80kD)
- transforming growth factor, beta receptor II (70/80kDa)
- AAT3
- EC 2.7.11.30
- FAA3
- HNPCC6
- MFS2
- RIIC 2
- TAAD2
- TGFR-2
- TGFBR2
- TGFbeta-RII
- TbetaR-II
|
| UniProt ID | P37173
|
| NCBI Gene ID | 7048 |
| GeneCard ID | GC03P030623 |
| SwissProt VARIANT ID | VAR_022351 |
| Comment | Loeys-Dietz syndrome type 2B (LDS2B) - Defects in TGFBR2 are the cause of Loeys-Dietz syndrome type 2B; formerly Marfan syndrome type 2. LDS2 is an aortic aneurysm syndrome with widespread systemic involvement. Physical findings include prominent joint laxity, easy bruising, wide and atrophic scars, velvety and translucent skin with easily visible veins, spontaneous rupture of the spleen or bowel, diffuse arterial aneurysms and dissections, and catastrophic complications of pregnancy, including rupture of the gravid uterus and the arteries, either during pregnancy or in the immediate postpartum period. LDS2 is characterized by the absence of craniofacial abnormalities with the exception of bifid uvula that can be present in some patients; Has a negative effect on TGF-beta signaling |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000303, Ag000304
Alignment of all Isoforms |
| Mutation entries | Ag000564, Ag000565, Ag000566, Ag003816, Ag003817, Ag003818, Ag003819, Ag003820, Ag003821, Ag003822, Ag003823, Ag003824, Ag003825, Ag003826, Ag003827, Ag003828, Ag003829, Ag003830, Ag003831, Ag003832, Ag003833, Ag003834, Ag003835, Ag003836
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | KTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFH |
| Antigen sequence | KTEKDIFSDINLKHENILQFPTAEERKTELGKQYWLITAFH |
|