| AgACC | Ag003607 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | WT1 |
| Full Name | Wilms tumor 1 |
| Synonym | Wilms' tumor protein; GUD; WAGR; WIT-2; WT33; WT1
another display format
- Wilms' tumor protein
- GUD
- WAGR
- WIT-2
- WT33
- WT1
|
| UniProt ID | P19544
|
| NCBI Gene ID | 7490 |
| GeneCard ID | GC11M032365 |
| SwissProt VARIANT ID | VAR_015060 |
| Comment | Frasier syndrome (FS) - Defects in WT1 are the cause of Frasier syndrome. FS is characterized by a slowly progressing nephropathy leading to renal failure in adolescence or early adulthood, male pseudohermaphroditism, and no Wilms tumor. As for histological findings of the kidneys, focal glomerular sclerosis is often observed. There is phenotypic overlap with Denys-Drash syndrome. Inheritance is autosomal dominant |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000203, Ag000204, Ag000205, Ag000206, Ag000207, Ag001874, Ag001875, Ag001876
Alignment of all Isoforms |
| Mutation entries | Ag001542, Ag001543, Ag001544, Ag001545, Ag001546, Ag001547, Ag001548, Ag001549, Ag001550, Ag001551, Ag001552, Ag001553, Ag001554, Ag001555, Ag001556, Ag001557
... Display all entries
Ag001558, Ag001559, Ag003584, Ag003585, Ag003586, Ag003587, Ag003588, Ag003589, Ag003590, Ag003591, Ag003592, Ag003593, Ag003594, Ag003595, Ag003596, Ag003597, Ag003598, Ag003599, Ag003600, Ag003601, Ag003602, Ag003603, Ag003604, Ag003605, Ag003606, Ag003607, Ag003608, Ag003609, Ag003610, Ag003611, Ag003612, Ag003613, Ag003614, Ag003615, Ag003616
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | RHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEK |
| Antigen sequence | RHQRRHTGVKPFQCKTCQRKLSRSDHLKTHTRTHTGKTSEK |
|