| AgACC | Ag003602 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | WT1 |
| Full Name | Wilms tumor 1 |
| Synonym | Wilms' tumor protein; GUD; WAGR; WIT-2; WT33; WT1
another display format
- Wilms' tumor protein
- GUD
- WAGR
- WIT-2
- WT33
- WT1
|
| UniProt ID | P19544
|
| NCBI Gene ID | 7490 |
| GeneCard ID | GC11M032365 |
| SwissProt VARIANT ID | VAR_007749 |
| Comment | Isolated diffuse mesangial sclerosis (IDMS) - Defects in WT1 are the cause of isolated diffuse mesangial sclerosis. IDMS is an early-onset nephrotic syndrome occurring in the absence of other abnormalities and resulting in renal failure. Inheritance is autosomal recessive |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000203, Ag000204, Ag000205, Ag000206, Ag000207, Ag001874, Ag001875, Ag001876
Alignment of all Isoforms |
| Mutation entries | Ag001542, Ag001543, Ag001544, Ag001545, Ag001546, Ag001547, Ag001548, Ag001549, Ag001550, Ag001551, Ag001552, Ag001553, Ag001554, Ag001555, Ag001556, Ag001557
... Display all entries
Ag001558, Ag001559, Ag003584, Ag003585, Ag003586, Ag003587, Ag003588, Ag003589, Ag003590, Ag003591, Ag003592, Ag003593, Ag003594, Ag003595, Ag003596, Ag003597, Ag003598, Ag003599, Ag003600, Ag003601, Ag003602, Ag003603, Ag003604, Ag003605, Ag003606, Ag003607, Ag003608, Ag003609, Ag003610, Ag003611, Ag003612, Ag003613, Ag003614, Ag003615, Ag003616
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | RFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTR |
| Antigen sequence | RFSRSDQLKRHQRRHTGVKPLQCKTCQRKFSRSDHLKTHTR |
|