| AgACC | Ag003595 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | WT1 |
| Full Name | Wilms tumor 1 |
| Synonym | Wilms' tumor protein; GUD; WAGR; WIT-2; WT33; WT1
another display format
- Wilms' tumor protein
- GUD
- WAGR
- WIT-2
- WT33
- WT1
|
| UniProt ID | P19544
|
| NCBI Gene ID | 7490 |
| GeneCard ID | GC11M032365 |
| SwissProt VARIANT ID | VAR_007746 |
| Comment | Denys-Drash syndrome (DDS) - Defects in WT1 are the cause of Denys-Drash syndrome. DDS is a typical nephropathy characterized by diffuse mesangial sclerosis, genital abnormalities, and/or Wilms tumor. There is phenotypic overlap with WAGR syndrome and Frasier syndrome. Inheritance is autosomal dominant, but most cases are sporadic. Wilms tumor 1 (WT1) - Defects in WT1 are the cause of Wilms tumor 1 (WT1). WT is an embryonal malignancy of the kidney that affects approximately 1 in 10'000 infants and young children. It occurs both in sporadic and hereditary forms |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000203, Ag000204, Ag000205, Ag000206, Ag000207, Ag001874, Ag001875, Ag001876
Alignment of all Isoforms |
| Mutation entries | Ag001542, Ag001543, Ag001544, Ag001545, Ag001546, Ag001547, Ag001548, Ag001549, Ag001550, Ag001551, Ag001552, Ag001553, Ag001554, Ag001555, Ag001556, Ag001557 ... Display all entries
Ag001558, Ag001559, Ag003584, Ag003585, Ag003586, Ag003587, Ag003588, Ag003589, Ag003590, Ag003591, Ag003592, Ag003593, Ag003594, Ag003595, Ag003596, Ag003597, Ag003598, Ag003599, Ag003600, Ag003601, Ag003602, Ag003603, Ag003604, Ag003605, Ag003606, Ag003607, Ag003608, Ag003609, Ag003610, Ag003611, Ag003612, Ag003613, Ag003614, Ag003615, Ag003616
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | KHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCK |
| Antigen sequence | KHTGEKPYQCDFKDCERRFSHSDQLKRHQRRHTGVKPFQCK |
|