Antigen Record Ag001313

AgACC	Ag001313
Date	29-03-2008
Last updated	14-12-2016
Antigen Name	ERBB2
Common Name	HER2
Full Name	Receptor tyrosine-protein kinase erbB-2
Synonym	CD340 antigen; MLN 19; NEU proto-oncogene; Tyrosine kinase-type cell surface receptor HER2; c-erb B2; c-erbB2/neu protein; neuroblastoma/glioblastoma derived oncogene homolog; tyrosine kinase-type cell surface receptor; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog; neuro/glioblastoma derived oncogene homolog; v-erb-b2 erythroblastic leukemia viral oncogene homolog; neuo/glioblastoma derived oncogene homolog (avain); c-erbB-2; EC 2.7.10.1; HER-2; HER-2/neu; HER2; NEU; NGL; TKR1; erb-2; herstatin; p185erbB2 another display format CD340 antigen MLN 19 NEU proto-oncogene Tyrosine kinase-type cell surface receptor HER2 c-erb B2 c-erbB2/neu protein neuroblastoma/glioblastoma derived oncogene homolog tyrosine kinase-type cell surface receptor v-erb-b2 avian erythroblastic leukemia viral oncogene homolog neuro/glioblastoma derived oncogene homolog v-erb-b2 erythroblastic leukemia viral oncogene homolog neuo/glioblastoma derived oncogene homolog (avain) c-erbB-2 EC 2.7.10.1 HER-2 HER-2/neu HER2 NEU NGL TKR1 erb-2 herstatin p185erbB2
UniProt ID	P04626
NCBI Gene ID	2064
GeneCard ID	GC17P039687
COSMIC ID	14066
Annotation	This is a fragment sequence.
Isoforms	Ag000001, Ag001732 Alignment of all Isoforms
Mutation entries	Ag001291, Ag001292, Ag001293, Ag001294, Ag001295, Ag001296, Ag001297, Ag001298, Ag001299, Ag001300, Ag001301, Ag001302, Ag001303, Ag001304, Ag001305, Ag001306, Ag001307, Ag001308, Ag001309, Ag001310, Ag001311, Ag001312, Ag001313, Ag001314, Ag002176, Ag002177, Ag002178, Ag002179, Ag002180, Ag002181, Ag004463 View mutation map
RNA/protein expression profile	RNA and protein Expression profile
Predicted HLA binders	Allele: predictions Peptide length:
Reference sequence	EYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELM
Antigen sequence	EYHADGGKVPIKWMALESILCRRFTHQSDVWSYGVTVWELM