| AgACC | Ag001297 |
| Date | 29-03-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | ERBB2 |
| Common Name | HER2 |
| Full Name | Receptor tyrosine-protein kinase erbB-2 |
| Synonym | CD340 antigen; MLN 19; NEU proto-oncogene; Tyrosine kinase-type cell surface receptor HER2; c-erb B2; c-erbB2/neu protein; neuroblastoma/glioblastoma derived oncogene homolog; tyrosine kinase-type cell surface receptor; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog; neuro/glioblastoma derived oncogene homolog; v-erb-b2 erythroblastic leukemia viral oncogene homolog; neuo/glioblastoma derived oncogene homolog (avain); c-erbB-2; EC 2.7.10.1; HER-2; HER-2/neu; HER2; NEU; NGL; TKR1; erb-2; herstatin; p185erbB2
another display format
- CD340 antigen
- MLN 19
- NEU proto-oncogene
- Tyrosine kinase-type cell surface receptor HER2
- c-erb B2
- c-erbB2/neu protein
- neuroblastoma/glioblastoma derived oncogene homolog
- tyrosine kinase-type cell surface receptor
- v-erb-b2 avian erythroblastic leukemia viral oncogene homolog
- neuro/glioblastoma derived oncogene homolog
- v-erb-b2 erythroblastic leukemia viral oncogene homolog
- neuo/glioblastoma derived oncogene homolog (avain)
- c-erbB-2
- EC 2.7.10.1
- HER-2
- HER-2/neu
- HER2
- NEU
- NGL
- TKR1
- erb-2
- herstatin
- p185erbB2
|
| UniProt ID | P04626
|
| NCBI Gene ID | 2064 |
| GeneCard ID | GC17P039687 |
| COSMIC ID | 21604
|
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000001, Ag001732
Alignment of all Isoforms |
| Mutation entries | Ag001291, Ag001292, Ag001293, Ag001294, Ag001295, Ag001296, Ag001297, Ag001298, Ag001299, Ag001300, Ag001301, Ag001302, Ag001303, Ag001304, Ag001305, Ag001306, Ag001307, Ag001308, Ag001309, Ag001310, Ag001311, Ag001312, Ag001313, Ag001314, Ag002176, Ag002177, Ag002178, Ag002179, Ag002180, Ag002181, Ag004463
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | IPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP |
| Antigen sequence | IPDGENVKIPVAIKVLRENTFPKANKEILDEAYVMAGVGSP |
|