| AgACC | Ag002182 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | BIRC5 |
| Common Name | Survivin |
| Full Name | Baculoviral IAP repeat-containing protein 5 |
| Synonym | Survivin; Apoptosis inhibitor 4; Apoptosis inhibitor survivin; apoptosis inhibitor 4 (survivin); baculoviral IAP repeat-containing 5; API4; EPR-1; IAP4; SVV5
another display format
- Survivin
- Apoptosis inhibitor 4
- Apoptosis inhibitor survivin
- apoptosis inhibitor 4 (survivin)
- baculoviral IAP repeat-containing 5
- API4
- EPR-1
- IAP4
- SVV5
|
| UniProt ID | O15392
|
| NCBI Gene ID | 332 |
| GeneCard ID | GC17P078214 |
| SwissProt VARIANT ID | VAR_021071 |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000002, Ag000003, Ag000004, Ag000005, Ag000006, Ag000007, Ag000008
Alignment of all Isoforms |
| Mutation entries | Ag002182
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| HLA ligand | Ligand Sequence | Position | HLA allele | Reference |
| IAKETNNKK | 12-20 | A*0301 |
15779886 |
| IAKETNNKK | 12-20 | A*1101 |
15779886 |
| KIAKETNNK | 11-19 | A*0301 |
15779886 |
| KIAKETNNK | 11-19 | A*1101 |
15779886 |
| KLDRERAKN | 2-10 | A*0201 |
15779886 |
| KLDRERAKN | 2-10 | A*0301 |
15779886 |
| KVRRAIEQL | 29-37 | A*0201 |
15779886 |
| KVRRAIEQL | 29-37 | A*2402 |
15779886 |
| KVRRAIEQL | 29-37 | B*0702 |
15779886 |
| KVRRAIEQL | 29-37 | B*0801 |
15779886 |
| KVRRAIEQL | 29-37 | B*1501 |
15779886 |
| RAIEQLAAM | 32-40 | A*0201 |
15779886 |
| RAIEQLAAM | 32-40 | A*1101 |
15779886 |
| RAIEQLAAM | 32-40 | A*2402 |
15779886 |
| RAIEQLAAM | 32-40 | B*0702 |
15779886 |
| RAIEQLAAM | 32-40 | B*1501 |
15779886 |
| TAKKVRRAI | 26-34 | B*0702 |
15779886 |
| TAKKVRRAI | 26-34 | B*0801 |
15779886 |
| Predicted HLA binders | |
| Reference sequence | LKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD |
| Antigen sequence | LKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD |