| AgACC | Ag000004 |
| Date | 11-02-2007 |
| Last updated | 14-12-2016 |
| Antigen Name | BIRC5 |
| Common Name | Survivin |
| Full Name | Baculoviral IAP repeat-containing protein 5 |
| Synonym | Survivin; Apoptosis inhibitor 4; Apoptosis inhibitor survivin; apoptosis inhibitor 4 (survivin); baculoviral IAP repeat-containing 5; API4; EPR-1; IAP4; SVV5
another display format
- Survivin
- Apoptosis inhibitor 4
- Apoptosis inhibitor survivin
- apoptosis inhibitor 4 (survivin)
- baculoviral IAP repeat-containing 5
- API4
- EPR-1
- IAP4
- SVV5
|
| UniProt ID | O15392
|
| NCBI Gene ID | 332 |
| GeneCard ID | GC17P078214 |
| Comment | This sequence is a splice isoform and it was reported to be expressed in renal carcinoma, gastric cancer, acute and chronic lymphocytic leukemia (15611788). |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000002, Ag000003, Ag000005, Ag000006, Ag000007, Ag000008
Alignment of all Isoforms |
| Mutation entries | Ag002182
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| TLPPAWQPFL | 5-14 | A2 |
10987296 |
| HLA ligand | Ligand Sequence | Position | HLA allele | Reference |
| APTLPPAWQ | 3-11 | B*0702 |
15779886 |
| CFFCFKELE | 57-65 | A*2402 |
15779886 |
| CFKELEGWE | 60-68 | B*1501 |
15779886 |
| CTPERMAEA | 33-41 | A*0201 |
15779886 |
| DLAQCFFCF | 53-61 | A*2402 |
15779886 |
| EAGFIHCPT | 40-48 | A*2402 |
15779886 |
| EPDLAQCFF | 51-59 | A*2402 |
15779886 |
| FCFKELEGW | 59-67 | A*0201 |
15779886 |
| FCFKELEGW | 59-67 | A*2402 |
15779886 |
| FCFKELEGW | 59-67 | B*1501 |
15779886 |
| FFCFKELEG | 58-66 | A*2402 |
15779886 |
| FIHCPTENE | 43-51 | A*0201 |
15779886 |
| FLKDHRIST | 13-21 | A*0201 |
15779886 |
| FLKDHRIST | 13-21 | B*0801 |
15779886 |
| FLKDHRIST | 13-21 | B*1501 |
15779886 |
| GAPTLPPAW | 2-10 | A*2402 |
15779886 |
| HRISTFKNW | 17-25 | A*2402 |
15779886 |
| ISTFKNWPF | 19-27 | A*0201 |
15779886 |
| ISTFKNWPF | 19-27 | A*2402 |
15779886 |
| ISTFKNWPF | 19-27 | B*1501 |
15779886 |
| KDHRISTFK | 15-23 | A*0301 |
15779886 |
| KDHRISTFK | 15-23 | A*1101 |
15779886 |
| KNWPFLEGC | 23-31 | A*0201 |
15779886 |
| LKDHRISTF | 14-22 | A*2402 |
15779886 |
| LPPAWQPFL | 6-14 | A*0201 |
15779886 |
| LPPAWQPFL | 6-14 | A*2402 |
15779886 |
| LPPAWQPFL | 6-14 | B*0702 |
15779886 |
| MAEAGFIHC | 38-46 | A*0201 |
15779886 |
| MGAPTLPPA | 1-9 | A*0201 |
15779886 |
| MGAPTLPPA | 1-9 | A*1101 |
15779886 |
| NEPDLAQCF | 50-58 | A*2402 |
15779886 |
| PDLAQCFFC | 52-60 | A*0301 |
15779886 |
| PDLAQCFFC | 52-60 | A*1101 |
15779886 |
| PDLAQCFFC | 52-60 | A*2402 |
15779886 |
| PFLEGCACT | 26-34 | A*0201 |
15779886 |
| PFLKDHRIS | 12-20 | A*2402 |
15779886 |
| PPAWQPFLK | 7-15 | A*0301 |
15779886 |
| PPAWQPFLK | 7-15 | A*1101 |
15779886 |
| QCFFCFKEL | 56-64 | A*2402 |
15779886 |
| QPFLKDHRI | 11-19 | B*0702 |
15779886 |
| QPFLKDHRI | 11-19 | B*0801 |
15779886 |
| RISTFKNWP | 18-26 | A*0201 |
15779886 |
| RMAEAGFIH | 37-45 | A*0201 |
15779886 |
| RMAEAGFIH | 37-45 | A*0301 |
15779886 |
| RMAEAGFIH | 37-45 | A*1101 |
15779886 |
| RMAEAGFIH | 37-45 | A*2402 |
15779886 |
| RMAEAGFIH | 37-45 | B*1501 |
15779886 |
| STFKNWPFL | 20-28 | A*0201 |
15779886 |
| STFKNWPFL | 20-28 | A*0301 |
15779886 |
| STFKNWPFL | 20-28 | A*1101 |
15779886 |
| STFKNWPFL | 20-28 | A*2402 |
15779886 |
| TLPPAWQPF | 5-13 | A*0201 |
15779886 |
| TLPPAWQPF | 5-13 | A*2402 |
15779886 |
| TLPPAWQPF | 5-13 | B*1501 |
15779886 |
| WPFLEGCAC | 25-33 | A*2402 |
15779886 |
| WPFLEGCAC | 25-33 | B*0702 |
15779886 |
| Predicted HLA binders | |
| Antigen sequence | MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD
DDPMQRKPTIRRKNLRKLRRKCAVPSSSWLPWIEASGRSCLVPEWLHHFQGLFPGATSLPVGPLAMS |