| AgACC | Ag001562 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | BIRC5 |
| Common Name | Survivin |
| Full Name | Baculoviral IAP repeat-containing protein 5 |
| Synonym | Survivin; Apoptosis inhibitor 4; Apoptosis inhibitor survivin; apoptosis inhibitor 4 (survivin); baculoviral IAP repeat-containing 5; API4; EPR-1; IAP4; SVV5
another display format
- Survivin
- Apoptosis inhibitor 4
- Apoptosis inhibitor survivin
- apoptosis inhibitor 4 (survivin)
- baculoviral IAP repeat-containing 5
- API4
- EPR-1
- IAP4
- SVV5
|
| UniProt ID | A3E0Z8
|
| NCBI Gene ID | 332 |
| GeneCard ID | GC17P078214 |
| Comment | This sequence is a splice isoform. |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000002, Ag000003, Ag000004, Ag000005, Ag000006, Ag000007, Ag000008
Alignment of all Isoforms |
| Mutation entries | Ag002182
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| AYACNTSTL | 64-72 | A*0201 |
12060610 |
| HLA ligand | Ligand Sequence | Position | HLA allele | Reference |
| CFFCFKELE | 41-49 | A*2402 |
15779886 |
| CFKELEGWE | 44-52 | B*1501 |
15779886 |
| CTPERMAEA | 17-25 | A*0201 |
15779886 |
| DLAQCFFCF | 37-45 | A*2402 |
15779886 |
| EAGFIHCPT | 24-32 | A*2402 |
15779886 |
| EPDLAQCFF | 35-43 | A*2402 |
15779886 |
| FCFKELEGW | 43-51 | A*0201 |
15779886 |
| FCFKELEGW | 43-51 | A*2402 |
15779886 |
| FCFKELEGW | 43-51 | B*1501 |
15779886 |
| FFCFKELEG | 42-50 | A*2402 |
15779886 |
| FIHCPTENE | 27-35 | A*0201 |
15779886 |
| HRISTFKNW | 1-9 | A*2402 |
15779886 |
| ISTFKNWPF | 3-11 | A*0201 |
15779886 |
| ISTFKNWPF | 3-11 | A*2402 |
15779886 |
| ISTFKNWPF | 3-11 | B*1501 |
15779886 |
| KNWPFLEGC | 7-15 | A*0201 |
15779886 |
| MAEAGFIHC | 22-30 | A*0201 |
15779886 |
| NEPDLAQCF | 34-42 | A*2402 |
15779886 |
| PDLAQCFFC | 36-44 | A*0301 |
15779886 |
| PDLAQCFFC | 36-44 | A*1101 |
15779886 |
| PDLAQCFFC | 36-44 | A*2402 |
15779886 |
| PFLEGCACT | 10-18 | A*0201 |
15779886 |
| QCFFCFKEL | 40-48 | A*2402 |
15779886 |
| RISTFKNWP | 2-10 | A*0201 |
15779886 |
| RMAEAGFIH | 21-29 | A*0201 |
15779886 |
| RMAEAGFIH | 21-29 | A*0301 |
15779886 |
| RMAEAGFIH | 21-29 | A*1101 |
15779886 |
| RMAEAGFIH | 21-29 | A*2402 |
15779886 |
| RMAEAGFIH | 21-29 | B*1501 |
15779886 |
| STFKNWPFL | 4-12 | A*0201 |
15779886 |
| STFKNWPFL | 4-12 | A*0301 |
15779886 |
| STFKNWPFL | 4-12 | A*1101 |
15779886 |
| STFKNWPFL | 4-12 | A*2402 |
15779886 |
| WPFLEGCAC | 9-17 | A*2402 |
15779886 |
| WPFLEGCAC | 9-17 | B*0702 |
15779886 |
| Predicted HLA binders | |
| Antigen sequence | HRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIGPGTVAYACNTS
TLGGRGGRITRSGDRDHLG |