| AgACC | Ag004145 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | MFI2 |
| Common Name | Melanotransferrin |
| Full Name | Melanotransferrin |
| Synonym | CD228; FLJ38863; MAP97; MGC4856; MTF1; Antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5; CD228 antigen; Melanoma-associated antigen p97; Melanotransferrin precursor; antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5; melanoma-associated antigen p97, isoform 2
another display format
- CD228
- FLJ38863
- MAP97
- MGC4856
- MTF1
- Antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5
- CD228 antigen
- Melanoma-associated antigen p97
- Melanotransferrin precursor
- antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5
- melanoma-associated antigen p97, isoform 2
|
| UniProt ID | P08582
|
| NCBI Gene ID | 4241 |
| GeneCard ID | GC03M196987 |
| SwissProt VARIANT ID | VAR_020413 |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000516, Ag000517
Alignment of all Isoforms |
| Mutation entries | Ag004145
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | ARVPAHAVVVRADTDGGLIFRLLNEGQRLFSHEGSSFQMFS |
| Antigen sequence | ARVPAHAVVVRADTDGGLIFWLLNEGQRLFSHEGSSFQMFS |