| AgACC | Ag003802 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | MMP2 |
| Common Name | Matrix metalloproteinase-2 |
| Full Name | Matrix metalloproteinase 2 |
| Synonym | 72 kDa gelatinase; 72 kDa type IV collagenase precursor; 72kD type IV collagenase; Gelatinase A; Matrix metalloproteinase-2; TBE- 1; collagenase type IV-A; matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); matrix metalloproteinase-II; neutrophil gelatinase; CLG4; CLG4A; EC 3.4.24.24; MMP-2; MMP2; MMP-II; MONA; TBE-1
another display format
- 72 kDa gelatinase
- 72 kDa type IV collagenase precursor
- 72kD type IV collagenase
- Gelatinase A
- Matrix metalloproteinase-2
- TBE- 1
- collagenase type IV-A
- matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
- matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
- matrix metalloproteinase-II
- neutrophil gelatinase
- CLG4
- CLG4A
- EC 3.4.24.24
- MMP-2
- MMP2
- MMP-II
- MONA
- TBE-1
|
| UniProt ID | P08253
|
| NCBI Gene ID | 4313 |
| GeneCard ID | GC16P055424 |
| SwissProt VARIANT ID | VAR_032423 |
| Comment | Multicentric osteolysis nodulosis and arthropathy (MONA) - Defects in MMP2 are the cause of multicentric osteolysis nodulosis and arthropathy. Inherited osteolyses or 'vanishing bone' syndromes are rare disorders of unknown etiology characterized by destruction and resorption of affected bones. MONA is an autosomal recessive osteolysis with multicentric involvement characterized by carpal and tarsal resorption, crippling arthritic changes, marked osteoporosis, palmar and plantar subcutaneous nodules and distinctive facies |
| Annotation | This is a fragment sequence. |
| Mutation entries | Ag003802, Ag003803, Ag003804, Ag003805, Ag003806, Ag003807, Ag003808, Ag003809
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | FGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDK |
| Antigen sequence | FGLPQTGDLDQNTIETMRKPHCGNPDVANYNFFPRKPKWDK |