| AgACC | Ag003712 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | OCA2 |
| Common Name | P polypeptide |
| Full Name | Oculocutaneous albinism II (pink-eye dilution (murine) homolog) |
| Synonym | Melanocyte-specific transporter protein; P protein; Pink-eyed dilution protein homolog; oculocutaneous albinism II (pink-eye dilution homolog, mouse); BOCA, D15S12, EYCL3, P, PED, OCA2
another display format
- Melanocyte-specific transporter protein
- P protein
- Pink-eyed dilution protein homolog
- oculocutaneous albinism II (pink-eye dilution homolog, mouse)
- BOCA, D15S12, EYCL3, P, PED, OCA2
|
| UniProt ID | Q04671
|
| NCBI Gene ID | 4948 |
| GeneCard ID | GC15M027754 |
| SwissProt VARIANT ID | VAR_043702 |
| Comment | Oculocutaneous albinism type 2 (OCA2) - Defects in OCA2 are the cause of oculocutaneous albinism type 2. OCA2 is an autosomal recessive form of albinism, a disorder of pigmentation in the skin, hair, and eyes. The phenotype of patients with OCA2 is typically somewhat less severe than in those with tyrosinase-deficient OCA1. There are several forms of OCA2, from typical OCA to relatively mild 'autosomal recessive ocular albinism' (AROA). OCA2 is the most prevalent type of albinism throughout the world |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000217, Ag000218, Ag000219
Alignment of all Isoforms |
| Mutation entries | Ag003658, Ag003659, Ag003660, Ag003661, Ag003662, Ag003663, Ag003664, Ag003665, Ag003666, Ag003667, Ag003668, Ag003669, Ag003670, Ag003671, Ag003672, Ag003673 ... Display all entries
Ag003674, Ag003675, Ag003676, Ag003677, Ag003678, Ag003679, Ag003680, Ag003681, Ag003682, Ag003683, Ag003684, Ag003685, Ag003686, Ag003687, Ag003688, Ag003689, Ag003690, Ag003691, Ag003692, Ag003693, Ag003694, Ag003695, Ag003696, Ag003697, Ag003698, Ag003699, Ag003700, Ag003701, Ag003702, Ag003703, Ag003704, Ag003705, Ag003706, Ag003707, Ag003708, Ag003709, Ag003710, Ag003711, Ag003712
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | EQHGYGFSFMEFFRLGFPMMVVSCTVGMCYLLVAHVVVGWN |
| Antigen sequence | EQHGYGFSFMEFFRLGFPMMVVSCTVGMCHLLVAHVVVGWN |
|