| AgACC | Ag003671 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | OCA2 |
| Common Name | P polypeptide |
| Full Name | Oculocutaneous albinism II (pink-eye dilution (murine) homolog) |
| Synonym | Melanocyte-specific transporter protein; P protein; Pink-eyed dilution protein homolog; oculocutaneous albinism II (pink-eye dilution homolog, mouse); BOCA, D15S12, EYCL3, P, PED, OCA2
another display format
- Melanocyte-specific transporter protein
- P protein
- Pink-eyed dilution protein homolog
- oculocutaneous albinism II (pink-eye dilution homolog, mouse)
- BOCA, D15S12, EYCL3, P, PED, OCA2
|
| UniProt ID | Q04671
|
| NCBI Gene ID | 4948 |
| GeneCard ID | GC15M027754 |
| SwissProt VARIANT ID | VAR_020627 |
| Comment | In unclassified OCA |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000217, Ag000218, Ag000219
Alignment of all Isoforms |
| Mutation entries | Ag003658, Ag003659, Ag003660, Ag003661, Ag003662, Ag003663, Ag003664, Ag003665, Ag003666, Ag003667, Ag003668, Ag003669, Ag003670, Ag003671, Ag003672, Ag003673 ... Display all entries
Ag003674, Ag003675, Ag003676, Ag003677, Ag003678, Ag003679, Ag003680, Ag003681, Ag003682, Ag003683, Ag003684, Ag003685, Ag003686, Ag003687, Ag003688, Ag003689, Ag003690, Ag003691, Ag003692, Ag003693, Ag003694, Ag003695, Ag003696, Ag003697, Ag003698, Ag003699, Ag003700, Ag003701, Ag003702, Ag003703, Ag003704, Ag003705, Ag003706, Ag003707, Ag003708, Ag003709, Ag003710, Ag003711, Ag003712
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | QVTIATAILAGVYALIIFEIVHRTLAAMLGSLAALAALAVI |
| Antigen sequence | QVTIATAILAGVYALIIFEIMHRTLAAMLGSLAALAALAVI |
|