| AgACC | Ag003583 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | SOX10 |
| Full Name | SRY (sex-determining region Y)-box 10 |
| Synonym | SRY-related HMG-box gene 10; Transcription factor SOX-10; dominant megacolon, mouse, human homolog of; DOM; MGC15649; OTTHUMP00000028515; WS4; SOX10
another display format
- SRY-related HMG-box gene 10
- Transcription factor SOX-10
- dominant megacolon, mouse, human homolog of
- DOM
- MGC15649
- OTTHUMP00000028515
- WS4
- SOX10
|
| UniProt ID | P56693
|
| NCBI Gene ID | 6663 |
| GeneCard ID | GC22M039963 |
| SwissProt VARIANT ID | VAR_021386 |
| Comment | Yemenite deaf-blind hypopigmentation syndrome - Defects in SOX10 are a cause of Yemenite deaf-blind hypopigmentation syndrome. The disorder consists of cutaneous hypopigmented and hyperpigmented spots and patches, microcornea, coloboma and severe hearing loss. Another case observed in a girl with similar skin symptoms and hearing loss but without microcornea or coloboma is reported as a mild form of this syndrome |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000201, Ag001873
Alignment of all Isoforms |
| Mutation entries | Ag003583
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | AQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIE |
| Antigen sequence | AQAARRKLADQYPHLHNAELTKTLGKLWRLLNESDKRPFIE |