| AgACC | Ag003412 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | TYR |
| Common Name | Tyrosinase |
| Full Name | Tyrosinase |
| Synonym | Monophenol monooxygenase; Tumor rejection antigen AB; Tyrosinase precursor; tyrosinase (oculocutaneous albinism IA); TYR; EC 1.14.18.1; LB24-AB; OCA1A; OCAIA; SK29-AB
another display format
- Monophenol monooxygenase
- Tumor rejection antigen AB
- Tyrosinase precursor
- tyrosinase (oculocutaneous albinism IA)
- TYR
- EC 1.14.18.1
- LB24-AB
- OCA1A
- OCAIA
- SK29-AB
|
| UniProt ID | P14679
|
| NCBI Gene ID | 7299 |
| GeneCard ID | GC11P089177 |
| SwissProt VARIANT ID | VAR_007928 |
| Comment | In OCA-IA/IB |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000039, Ag000040
Alignment of all Isoforms |
| Mutation entries | Ag000190, Ag000192, Ag000193, Ag003362, Ag003363, Ag003364, Ag003365, Ag003366, Ag003367, Ag003368, Ag003369, Ag003370, Ag003371, Ag003372, Ag003373, Ag003374 ... Display all entries
Ag003375, Ag003376, Ag003377, Ag003378, Ag003379, Ag003380, Ag003381, Ag003382, Ag003383, Ag003384, Ag003385, Ag003386, Ag003387, Ag003388, Ag003389, Ag003390, Ag003391, Ag003392, Ag003393, Ag003394, Ag003395, Ag003396, Ag003397, Ag003398, Ag003399, Ag003400, Ag003401, Ag003402, Ag003403, Ag003404, Ag003405, Ag003406, Ag003407, Ag003408, Ag003409, Ag003410, Ag003411, Ag003412, Ag003413, Ag003414, Ag003415, Ag003416, Ag003417, Ag003418, Ag003419, Ag003420, Ag003421, Ag003422, Ag003423, Ag003424, Ag003425, Ag003426, Ag003427, Ag003428, Ag003429, Ag003430, Ag003431, Ag003432, Ag003433, Ag003434, Ag003435, Ag003436, Ag003437, Ag003438, Ag003439, Ag003440, Ag003441, Ag003442, Ag003443, Ag003444, Ag003445, Ag003446, Ag003447, Ag003448, Ag003449, Ag003450, Ag003451, Ag003452, Ag003453, Ag003454, Ag003455, Ag003456, Ag003457, Ag003458, Ag003459, Ag003460, Ag003461, Ag003462, Ag003463, Ag003464, Ag003465, Ag003466, Ag003467, Ag003468, Ag003469
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | IVCSRLEEYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPS |
| Antigen sequence | IVCSRLEEYNSHQSLCNGTPKGPLRRNPGNHDKSRTPRLPS |
|