| AgACC | Ag000040 |
| Date | 11-27-2007 |
| Last updated | 14-12-2016 |
| Antigen Name | TYR |
| Common Name | Tyrosinase |
| Full Name | Tyrosinase |
| Synonym | Monophenol monooxygenase; Tumor rejection antigen AB; Tyrosinase precursor; tyrosinase (oculocutaneous albinism IA); TYR; EC 1.14.18.1; LB24-AB; OCA1A; OCAIA; SK29-AB
another display format
- Monophenol monooxygenase
- Tumor rejection antigen AB
- Tyrosinase precursor
- tyrosinase (oculocutaneous albinism IA)
- TYR
- EC 1.14.18.1
- LB24-AB
- OCA1A
- OCAIA
- SK29-AB
|
| UniProt ID | P14679
|
| NCBI Gene ID | 7299 |
| GeneCard ID | GC11P089177 |
| Comment | This sequence is a splice isoform. |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000039
Alignment of all Isoforms |
| Mutation entries | Ag000190, Ag000192, Ag000193, Ag003362, Ag003363, Ag003364, Ag003365, Ag003366, Ag003367, Ag003368, Ag003369, Ag003370, Ag003371, Ag003372, Ag003373, Ag003374 ... Display all entries
Ag003375, Ag003376, Ag003377, Ag003378, Ag003379, Ag003380, Ag003381, Ag003382, Ag003383, Ag003384, Ag003385, Ag003386, Ag003387, Ag003388, Ag003389, Ag003390, Ag003391, Ag003392, Ag003393, Ag003394, Ag003395, Ag003396, Ag003397, Ag003398, Ag003399, Ag003400, Ag003401, Ag003402, Ag003403, Ag003404, Ag003405, Ag003406, Ag003407, Ag003408, Ag003409, Ag003410, Ag003411, Ag003412, Ag003413, Ag003414, Ag003415, Ag003416, Ag003417, Ag003418, Ag003419, Ag003420, Ag003421, Ag003422, Ag003423, Ag003424, Ag003425, Ag003426, Ag003427, Ag003428, Ag003429, Ag003430, Ag003431, Ag003432, Ag003433, Ag003434, Ag003435, Ag003436, Ag003437, Ag003438, Ag003439, Ag003440, Ag003441, Ag003442, Ag003443, Ag003444, Ag003445, Ag003446, Ag003447, Ag003448, Ag003449, Ag003450, Ag003451, Ag003452, Ag003453, Ag003454, Ag003455, Ag003456, Ag003457, Ag003458, Ag003459, Ag003460, Ag003461, Ag003462, Ag003463, Ag003464, Ag003465, Ag003466, Ag003467, Ag003468, Ag003469
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference | | ADVEFCLSL | 316-324 | B*4002 |
18612636 |
| AFLPWHRLF | 206-214 | A24 |
7543520 |
| AFLPWHRLFL | 206-215 | A24 |
7543520 |
| CLLWSFQTSA | 8-17 | A2 |
11395636 |
| EIWRDIDFAHE | 193-203 | DRB1*0405 |
9510558 |
| FLLRWEQEI | 214-222 | A2 |
9862732 |
| FLPWHRLFLL | 207-216 | A*0201 |
11093159 |
| KCDICTDEY | 243-251 | A1 |
9498746 |
| KLTGDENFTI | 224-233 | A*0201 |
11093159 |
| LPSSADVEF | 312-320 | B35 |
10597191 |
| LPSSADVEF | 312-320 | B*3501 |
10597191 |
| LPSSADVEF | 312-320 | B*3503 |
10597191 |
| MLLAVLYCL | 1-9 | A2 |
8125142 |
| QCSGNFMGF | 90-98 | A26 |
16247014 |
| QNILLSNAPLGPQFP | 56-70 | DRB1*0401 |
8642306 |
| SADVEFCLSL | 315-324 | B*4002 |
18612636 |
| SEIWRDID | 192-199 | B*4402 |
8566071 |
| SEIWRDID | 192-199 | B*4403 |
8566071 |
| SEIWRDIDF | 192-200 | B*4402 |
8566071 |
| SEIWRDIDF | 192-200 | B*4403 |
8566071 |
| SSDYVIPIGTY | 146-156 | A1 |
14724640 |
| TPRLPSSADVEF | 309-320 | B35 |
14634146 |
| YGQMKNGSTPMFNDINIYDL | 156-175 | DRB1*0401 |
9510558 |
| HLA ligand | Ligand Sequence | Position | HLA allele | Reference | | FLPWHRLFL | 207-215 | A2 |
9862732 |
| LLAVLYCLL | 2-10 | A2 |
9862732 |
| LLWSFQTSA | 9-17 | A2 |
9862732 |
| Predicted HLA binders | |
| Antigen sequence | MLLAVLYCLLWSFQTSAGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILLSNAPLGPQFP
FTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVRRNIFDLSAPEKDKFFAYLTL
AKHTISSDYVIPIGTYGQMKNGSTPMFNDINIYDLFVWMHYYVSMDALLGGSEIWRDIDFAHEAPAFLPW
HRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLE
EYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEEMGFL
HVGWAGLKLLTSRDPPPWPPKMLGLQA |
|