| AgACC | Ag002186 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | IL13RA2 |
| Common Name | Interleukin 13 receptor alpha 2 |
| Full Name | Interleukin-13 receptor alpha-2 chain precursor |
| Synonym | CD213a2 antigen; IL-13 receptor; Interleukin-13-binding protein; interleukin 13 binding protein; interleukin 13 receptor alpha 2 chain; interleukin 13 receptor; alpha 2; CD213A2; CD213a2; IL-13R; IL-13BP; IL13R; IL13RA2
another display format
- CD213a2 antigen
- IL-13 receptor
- Interleukin-13-binding protein
- interleukin 13 binding protein
- interleukin 13 receptor alpha 2 chain
- interleukin 13 receptor
- alpha 2
- CD213A2
- CD213a2
- IL-13R
- IL-13BP
- IL13R
- IL13RA2
|
| UniProt ID | Q14627
|
| NCBI Gene ID | 3598 |
| GeneCard ID | GC0XM115003 |
| SwissProt VARIANT ID | VAR_021256 |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000025, Ag001745
Alignment of all Isoforms |
| Mutation entries | Ag002186
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | YKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAETTYWIS |
| Antigen sequence | YKDGFDLNKGIEAKIHTLLPRQCTNGSEVQSSWAETTYWIS |