| AgACC | Ag001927 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | KLK4 |
| Full Name | Kallikrein-4 precursor |
| Synonym | Enamel matrix serine proteinase 1; Kallikrein-like protein 1; Serine protease 17; androgen-regulated message 1; enamel matrix serine protease 1; kallikrein 4 (prostase, enamel matrix, prostate); kallikrein-related peptidase 4; protease, serine, 17 ARM1, EC 3.4.21.-, EMSP, EMSP1, KLK-L1, MGC116827, MGC116828, PRSS17, PSTS, Prostase 3, KLK4
another display format
- Enamel matrix serine proteinase 1
- Kallikrein-like protein 1
- Serine protease 17
- androgen-regulated message 1
- enamel matrix serine protease 1
- kallikrein 4 (prostase, enamel matrix, prostate)
- kallikrein-related peptidase 4
- protease, serine, 17 ARM1, EC 3.4.21.-, EMSP, EMSP1, KLK-L1, MGC116827, MGC116828, PRSS17, PSTS, Prostase 3, KLK4
|
| UniProt ID | Q96PT0
|
| NCBI Gene ID | 9622 |
| GeneCard ID | GC19M050907 |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000282, Ag001924, Ag001925, Ag001926
Alignment of all Isoforms |
| Mutation entries | Ag003776, Ag003777, Ag003778
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference | | SVSESDTIRSISIAS | 125-139 | DP4 |
12077288 |
| SVSESDTIRSISIAS | 125-139 | DRB1*0401 |
12077288 |
| Predicted HLA binders | |
| Antigen sequence | MATAGNPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAA
HCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSISIASQ
CPTAGNSCLVSGWGLLANGELTGVCLPSSRRSSAQSRGLTQSSASQAECLPCCSA |
|