Antigen Record Ag000282

AgACCAg000282
Date11-02-2007
Last updated14-12-2016
Antigen NameKLK4
Full NameKallikrein-4 precursor
SynonymEnamel matrix serine proteinase 1; Kallikrein-like protein 1; Serine protease 17; androgen-regulated message 1; enamel matrix serine protease 1; kallikrein 4 (prostase, enamel matrix, prostate); kallikrein-related peptidase 4; protease, serine, 17 ARM1, EC 3.4.21.-, EMSP, EMSP1, KLK-L1, MGC116827, MGC116828, PRSS17, PSTS, Prostase 3, KLK4

another display format
  • Enamel matrix serine proteinase 1
  • Kallikrein-like protein 1
  • Serine protease 17
  • androgen-regulated message 1
  • enamel matrix serine protease 1
  • kallikrein 4 (prostase, enamel matrix, prostate)
  • kallikrein-related peptidase 4
  • protease, serine, 17 ARM1, EC 3.4.21.-, EMSP, EMSP1, KLK-L1, MGC116827, MGC116828, PRSS17, PSTS, Prostase 3, KLK4
UniProt IDQ9Y5K2
NCBI Gene ID9622
GeneCard IDGC19M050907
AnnotationThis is a full length sequence.
IsoformsAg001924,  Ag001925,  Ag001926,  Ag001927

Alignment of all Isoforms
Mutation entriesAg003776,  Ag003777,  Ag003778

View mutation map
RNA/protein expression profileRNA and protein Expression profile
T cell epitopeEpitope sequencePositionHLA alleleReference
LLANGRMPTVLQCVN155-169 DRB1*0404  12077288
RMPTVLQCVNVSVVS160-174 DR7  12077288
SVSESDTIRSISIAS125-139 DP4  12077288
SVSESDTIRSISIAS125-139 DRB1*0401  12077288
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMATAGNPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAA
HCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSISIASQ
CPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGQDQKDSCNGDSGGP
LICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS