| AgACC | Ag001070 |
| Date | 29-03-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | CTNNB1 |
| Full Name | Catenin beta-1 |
| Synonym | catenin; caherin-associated protein beta 1(88kD); Beta-catenin; CTNNB; CTNNB1; FLJ25606
another display format
- catenin
- caherin-associated protein beta 1(88kD)
- Beta-catenin
- CTNNB
- CTNNB1
- FLJ25606
|
| UniProt ID | P35222
|
| NCBI Gene ID | 1499 |
| GeneCard ID | GC03P041236 |
| COSMIC ID | 5713
|
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000058, Ag000060
Alignment of all Isoforms |
| Mutation entries | Ag000059, Ag001021, Ag001022, Ag001023, Ag001024, Ag001025, Ag001026, Ag001027, Ag001028, Ag001029, Ag001030, Ag001031, Ag001032, Ag001033, Ag001034, Ag001035 ... Display all entries
Ag001036, Ag001037, Ag001038, Ag001039, Ag001040, Ag001041, Ag001042, Ag001043, Ag001044, Ag001045, Ag001046, Ag001047, Ag001048, Ag001049, Ag001050, Ag001051, Ag001052, Ag001053, Ag001054, Ag001055, Ag001056, Ag001057, Ag001058, Ag001059, Ag001060, Ag001061, Ag001062, Ag001063, Ag001064, Ag001066, Ag001067, Ag001068, Ag001069, Ag001070, Ag001071, Ag001072, Ag001073, Ag001074, Ag001075, Ag001077, Ag001078, Ag001079, Ag001080, Ag001081, Ag001082, Ag001083, Ag001084, Ag001085, Ag001086, Ag001087, Ag001088, Ag001089, Ag001090, Ag001091, Ag001092, Ag001093, Ag001094, Ag001095, Ag001096, Ag001097, Ag001098, Ag001099, Ag001100, Ag001101, Ag001102, Ag001103, Ag001104, Ag001105, Ag001106, Ag001107, Ag001108, Ag001109, Ag001110, Ag001111, Ag001112, Ag001113, Ag001114, Ag001115, Ag001116, Ag001117, Ag001118, Ag001119, Ag001120, Ag001121, Ag001122, Ag001123, Ag001124, Ag001125, Ag001126, Ag001127, Ag001128, Ag001129, Ag001130, Ag001131, Ag003481
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | RKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVD |
| Antigen sequence | RKAAVSHWQQQSYLDSGIHSDATTTAPSLSGKGNPEEEDVD |
|