| AgACC | Ag000060 |
| Date | 11-02-2007 |
| Last updated | 14-12-2016 |
| Antigen Name | CTNNB1 |
| Full Name | Catenin beta-1 |
| Synonym | catenin; caherin-associated protein beta 1(88kD); Beta-catenin; CTNNB; CTNNB1; FLJ25606
another display format
- catenin
- caherin-associated protein beta 1(88kD)
- Beta-catenin
- CTNNB
- CTNNB1
- FLJ25606
|
| UniProt ID | P35222
|
| NCBI Gene ID | 1499 |
| GeneCard ID | GC03P041236 |
| Comment | This sequence is a splice isoform. |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000058
Alignment of all Isoforms |
| Mutation entries | Ag000059, Ag001021, Ag001022, Ag001023, Ag001024, Ag001025, Ag001026, Ag001027, Ag001028, Ag001029, Ag001030, Ag001031, Ag001032, Ag001033, Ag001034, Ag001035
... Display all entries
Ag001036, Ag001037, Ag001038, Ag001039, Ag001040, Ag001041, Ag001042, Ag001043, Ag001044, Ag001045, Ag001046, Ag001047, Ag001048, Ag001049, Ag001050, Ag001051, Ag001052, Ag001053, Ag001054, Ag001055, Ag001056, Ag001057, Ag001058, Ag001059, Ag001060, Ag001061, Ag001062, Ag001063, Ag001064, Ag001066, Ag001067, Ag001068, Ag001069, Ag001070, Ag001071, Ag001072, Ag001073, Ag001074, Ag001075, Ag001077, Ag001078, Ag001079, Ag001080, Ag001081, Ag001082, Ag001083, Ag001084, Ag001085, Ag001086, Ag001087, Ag001088, Ag001089, Ag001090, Ag001091, Ag001092, Ag001093, Ag001094, Ag001095, Ag001096, Ag001097, Ag001098, Ag001099, Ag001100, Ag001101, Ag001102, Ag001103, Ag001104, Ag001105, Ag001106, Ag001107, Ag001108, Ag001109, Ag001110, Ag001111, Ag001112, Ag001113, Ag001114, Ag001115, Ag001116, Ag001117, Ag001118, Ag001119, Ag001120, Ag001121, Ag001122, Ag001123, Ag001124, Ag001125, Ag001126, Ag001127, Ag001128, Ag001129, Ag001130, Ag001131, Ag003481
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Antigen sequence | MEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEG
ATAPLTELLHSRNEGVGK |
|