Antigen Record Ag000392

AgACCAg000392
Date11-02-2007
Last updated14-12-2016
Antigen NameUBE2V1
Common NameUbiquitin-conjugating enzyme variant Kua
Full NameUbiquitin-conjugating enzyme E2 variant 1
SynonymDNA-binding protein; Human putative DNA-binding protein mRNA, partial cds; TRAF6-regulated IKK activator 1 beta Uev1A; Ubiquitin-conjugating enzyme variant Kua; Ubiquitin-conjugating enzyme E2 variant; CIRQ; CROC-1; CROC1; UBE2V; UEV-1; UEV1; UEV1A

another display format
  • DNA-binding protein
  • Human putative DNA-binding protein mRNA, partial cds
  • TRAF6-regulated IKK activator 1 beta Uev1A
  • Ubiquitin-conjugating enzyme variant Kua
  • Ubiquitin-conjugating enzyme E2 variant
  • CIRQ
  • CROC-1
  • CROC1
  • UBE2V
  • UEV-1
  • UEV1
  • UEV1A
UniProt IDQ13404
NCBI Gene ID7335
GeneCard IDGC20M050082
CommentThis is a splice isoform.
AnnotationThis is a full length sequence.
IsoformsAg000387Ag000388Ag000389Ag000390Ag000391Ag000393Ag002040

Alignment of all Isoforms
RNA/protein expression profileRNA and protein Expression profile
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMKEDLNLENFTAKTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNS
YSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN