| AgACC | Ag000314 |
| Date | 11-02-2007 |
| Last updated | 14-12-2016 |
| Antigen Name | AKAP13 |
| Common Name | Lymphoid blast crisis oncogene (Lbc) oncoproptein |
| Full Name | A kinase anchor protein 13 |
| Synonym | Lymphoid blast crisis oncogene A kinase (PRKA) anchor protein 13; A-kinase anchor protein 13; A-kinase anchoring protein, AKAP 13; Breast cancer nuclear receptor-binding auxiliary protein; Guanine nucleotide exchange factor Lbc; Human thyroid-anchoring protein 31; LBC oncogene; Lymphoid blast crisis oncogene; Non-oncogenic Rho GTPase-specific GTP exchange factor; PROTO-LB LBC; Protein kinase A-anchoring protein 13; AKAP-Lbc; BRX; FLJ11952; FLJ43341; HA-3; HT31; Ht31; LBC; P47; PROTO-LB; PROTO-LBC; c-lbc; AKAP13
another display format
- Lymphoid blast crisis oncogene A kinase (PRKA) anchor protein 13
- A-kinase anchor protein 13
- A-kinase anchoring protein, AKAP 13
- Breast cancer nuclear receptor-binding auxiliary protein
- Guanine nucleotide exchange factor Lbc
- Human thyroid-anchoring protein 31
- LBC oncogene
- Lymphoid blast crisis oncogene
- Non-oncogenic Rho GTPase-specific GTP exchange factor
- PROTO-LB LBC
- Protein kinase A-anchoring protein 13
- AKAP-Lbc
- BRX
- FLJ11952
- FLJ43341
- HA-3
- HT31
- Ht31
- LBC
- P47
- PROTO-LB
- PROTO-LBC
- c-lbc
- AKAP13
|
| UniProt ID | Q12802
|
| NCBI Gene ID | 11214 |
| GeneCard ID | GC15P085381 |
| Comment | This is a putative sequence. |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000307, Ag000308, Ag000309, Ag000310, Ag000311, Ag000312, Ag000313
Alignment of all Isoforms |
| Mutation entries | Ag000314, Ag000539, Ag003838, Ag003839, Ag003840, Ag003841, Ag003842, Ag003843, Ag003844, Ag003845, Ag003846, Ag003847, Ag003848
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| VTEPGTAQY | 20-28 | A1 |
12663445 |
| Predicted HLA binders | |
| Reference sequence | MPTDQESLSSGDAVLQRDLVMEPGTAQYSSGGELGGISTTN |
| Antigen sequence | MPTDQESLSSGDAVLQRDLVTEPGTAQYSSGGELGGISTTN |