Antigen Record Ag000314

AgACC	Ag000314
Date	11-02-2007
Last updated	14-12-2016
Antigen Name	AKAP13
Common Name	Lymphoid blast crisis oncogene (Lbc) oncoproptein
Full Name	A kinase anchor protein 13
Synonym	Lymphoid blast crisis oncogene A kinase (PRKA) anchor protein 13; A-kinase anchor protein 13; A-kinase anchoring protein, AKAP 13; Breast cancer nuclear receptor-binding auxiliary protein; Guanine nucleotide exchange factor Lbc; Human thyroid-anchoring protein 31; LBC oncogene; Lymphoid blast crisis oncogene; Non-oncogenic Rho GTPase-specific GTP exchange factor; PROTO-LB LBC; Protein kinase A-anchoring protein 13; AKAP-Lbc; BRX; FLJ11952; FLJ43341; HA-3; HT31; Ht31; LBC; P47; PROTO-LB; PROTO-LBC; c-lbc; AKAP13 another display format Lymphoid blast crisis oncogene A kinase (PRKA) anchor protein 13 A-kinase anchor protein 13 A-kinase anchoring protein, AKAP 13 Breast cancer nuclear receptor-binding auxiliary protein Guanine nucleotide exchange factor Lbc Human thyroid-anchoring protein 31 LBC oncogene Lymphoid blast crisis oncogene Non-oncogenic Rho GTPase-specific GTP exchange factor PROTO-LB LBC Protein kinase A-anchoring protein 13 AKAP-Lbc BRX FLJ11952 FLJ43341 HA-3 HT31 Ht31 LBC P47 PROTO-LB PROTO-LBC c-lbc AKAP13
UniProt ID	Q12802
NCBI Gene ID	11214
GeneCard ID	GC15P085381
Comment	This is a putative sequence.
Annotation	This is a fragment sequence.
Isoforms	Ag000307, Ag000308, Ag000309, Ag000310, Ag000311, Ag000312, Ag000313 Alignment of all Isoforms
Mutation entries	Ag000314, Ag000539, Ag003838, Ag003839, Ag003840, Ag003841, Ag003842, Ag003843, Ag003844, Ag003845, Ag003846, Ag003847, Ag003848 View mutation map
RNA/protein expression profile	RNA and protein Expression profile
T cell epitope	Epitope sequence	Position	HLA allele	Reference
	VTEPGTAQY	20-28	A1	12663445
Predicted HLA binders	Allele: predictions Peptide length:
Reference sequence	MPTDQESLSSGDAVLQRDLVMEPGTAQYSSGGELGGISTTN
Antigen sequence	MPTDQESLSSGDAVLQRDLVTEPGTAQYSSGGELGGISTTN