| AgACC | Ag004171 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | MET |
| Common Name | c-Met protein |
| Full Name | Met proto-oncogene (hepatocyte growth factor receptor) |
| Synonym | AUTS9; EC 2.7.10.1; HGFR; RCCP2; c-Met; HGF receptor; HGF/SF receptor; Hepatocyte growth factor receptor precursor; Met proto-oncogene tyrosine kinase; Oncogene MET; SF receptor; Scatter factor receptor; met proto-oncogene; met proto-oncogene (hepatocyte growth factor receptor)
another display format
- AUTS9
- EC 2.7.10.1
- HGFR
- RCCP2
- c-Met
- HGF receptor
- HGF/SF receptor
- Hepatocyte growth factor receptor precursor
- Met proto-oncogene tyrosine kinase
- Oncogene MET
- SF receptor
- Scatter factor receptor
- met proto-oncogene
- met proto-oncogene (hepatocyte growth factor receptor)
|
| UniProt ID | P08581
|
| NCBI Gene ID | 4233 |
| GeneCard ID | GC07P116672 |
| SwissProt VARIANT ID | VAR_006286 |
| Comment | Hereditary papillary renal carcinoma (HPRC) - Defects in MET are a cause of hereditary papillary renal carcinoma; also known as papillary renal cell carcinoma 2 (RCCP2). HPRC is a form of inherited kidney cancer characterized by a predisposition to develop multiple, bilateral papillary renal tumors. The pattern of inheritance is consistent with autosomal dominant transmission with reduced penetrance; Germline mutation |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000524, Ag000525, Ag002146
Alignment of all Isoforms |
| Mutation entries | Ag004155, Ag004156, Ag004157, Ag004158, Ag004159, Ag004160, Ag004161, Ag004162, Ag004163, Ag004164, Ag004165, Ag004166, Ag004167, Ag004168, Ag004169, Ag004170, Ag004171, Ag004172, Ag004173, Ag004174, Ag004175, Ag004176, Ag004177, Ag004178, Ag004179, Ag004180, Ag004181, Ag004182, Ag004183
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | SLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEG |
| Antigen sequence | SLNRITDIGEVSQFLTEGIITKDFSHPNVLSLLGICLRSEG |
|