| AgACC | Ag004116 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | CDKN1A |
| Common Name | cyclin-dependent kinase inhibitor 1A (CDKN1A) |
| Full Name | Cyclin-dependent kinase inhibitor 1A (p21, Cip1) |
| Synonym | CAP20; CDKN1; CIP1; MDA-6; MDA6; P21; PIC1; SDI1; WAF1; p21; p21CIP1; CDK-interacting protein 1; CDK-interaction protein 1; Cyclin-dependent kinase inhibitor 1; DNA synthesis inhibitor; Melanoma differentiation-associated protein 6; cyclin-dependent kinase inhibitor 1A; cyclin-dependent kinase inhibitor 1A (p21, Cip1); melanoma differentiation associated protein 6; wild-type p53-activated fragment 1
another display format
- CAP20
- CDKN1
- CIP1
- MDA-6
- MDA6
- P21
- PIC1
- SDI1
- WAF1
- p21
- p21CIP1
- CDK-interacting protein 1
- CDK-interaction protein 1
- Cyclin-dependent kinase inhibitor 1
- DNA synthesis inhibitor
- Melanoma differentiation-associated protein 6
- cyclin-dependent kinase inhibitor 1A
- cyclin-dependent kinase inhibitor 1A (p21, Cip1)
- melanoma differentiation associated protein 6
- wild-type p53-activated fragment 1
|
| UniProt ID | P38936
|
| NCBI Gene ID | 1026 |
| GeneCard ID | GC06P036754 |
| SwissProt VARIANT ID | VAR_014875 |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000473, Ag002102
Alignment of all Isoforms |
| Mutation entries | Ag004115, Ag004116
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | GEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP |
| Antigen sequence | GEQAEGSPGGPGDSQGRKRRQTSMTGFYHSKRRLIFSKRKP |