| AgACC | Ag004061 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | ABCC3 |
| Common Name | Multidrug resistance-associated protein 3 (MRP3) |
| Full Name | ATP-binding cassette, sub-family C (CFTR/MRP), member 3 |
| Synonym | ATP-binding cassette sub-family C member 3; ATP-binding cassette, sub-family C (CFTR/MRP), member 3; ATP-binding cassette, sub-family C, member 3; Canalicular multispecific organic anion transporter 2; Highly similar to MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1 [Homo sapiens]; Multi-specific organic anion transporter-D; Multidrug resistance-associated protein 3; canicular multispecific organic anion transporter; multidrug resistance associated protein; ABC31; CMOAT2; EST90757; MLP2; MOAT-D; MRP3; cMOAT2
another display format
- ATP-binding cassette sub-family C member 3
- ATP-binding cassette, sub-family C (CFTR/MRP), member 3
- ATP-binding cassette, sub-family C, member 3
- Canalicular multispecific organic anion transporter 2
- Highly similar to MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1 [Homo sapiens]
- Multi-specific organic anion transporter-D
- Multidrug resistance-associated protein 3
- canicular multispecific organic anion transporter
- multidrug resistance associated protein
- ABC31
- CMOAT2
- EST90757
- MLP2
- MOAT-D
- MRP3
- cMOAT2
|
| UniProt ID | O15438
|
| NCBI Gene ID | 8714 |
| GeneCard ID | GC17P050634 |
| SwissProt VARIANT ID | VAR_020240 |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000410, Ag000411, Ag000412, Ag000413, Ag002054
Alignment of all Isoforms |
| Mutation entries | Ag004054, Ag004055, Ag004056, Ag004057, Ag004058, Ag004059, Ag004060, Ag004061
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | DLRSQLTIIPQDPILFSGTLRMNLDPFGSYSEEDIWWALEL |
| Antigen sequence | DLRSQLTIIPQDPILFSGTLSMNLDPFGSYSEEDIWWALEL |