| AgACC | Ag003629 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | MC1R |
| Full Name | Melanocortin receptor |
| Synonym | Melanocyte-stimulating hormone receptor; Melanotropin receptor; melanocortin 1 receptor; melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor); melanocyte stimulating hormone receptor; MC1-R; MGC14337; MSH-R; MSHR
another display format
- Melanocyte-stimulating hormone receptor
- Melanotropin receptor
- melanocortin 1 receptor
- melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor)
- melanocyte stimulating hormone receptor
- MC1-R
- MGC14337
- MSH-R
- MSHR
|
| UniProt ID | Q01726
|
| NCBI Gene ID | 4157 |
| GeneCard ID | GC16P089912 |
| SwissProt VARIANT ID | VAR_042661 |
| Comment | Shows a moderate and not significant decrease of cAMP production to NDP-MSH stimulation; shows a not significant decrease in cAMP production at any concentrations of NDP-MSH stimulation |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000214, Ag001879, Ag001880, Ag001881, Ag001882, Ag001883, Ag001884, Ag001885, Ag001886, Ag001887, Ag001888, Ag001889, Ag001890, Ag001891, Ag001892, Ag001893, Ag001894, Ag001895, Ag001897, Ag001898, Ag001899
Alignment of all Isoforms |
| Mutation entries | Ag003618, Ag003619, Ag003620, Ag003621, Ag003622, Ag003623, Ag003624, Ag003625, Ag003626, Ag003627, Ag003628, Ag003629, Ag003630, Ag003631, Ag003632, Ag003633
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | IFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFIAYYDHV |
| Antigen sequence | IFYALRYHSIVTLPRARRAVGAIWVASVVFSTLFIAYYDHV |
|