| AgACC | Ag003527 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | EPHA2 |
| Common Name | EphA2 |
| Full Name | Ephrin type-A receptor 2 precursor |
| Synonym | EPH receptor A2; Epithelial cell kinase; Tyrosine-protein kinase receptor ECK; ephrin receptor EPHA2; epithelial cell receptor protein tyosine kinase; protein tyrosine kinase; protein tyrosine kinase; receptor protein tyrosine kinase regulated by p53 and E2F-1; EC2.7.10.1; ECK
another display format
- EPH receptor A2
- Epithelial cell kinase
- Tyrosine-protein kinase receptor ECK
- ephrin receptor EPHA2
- epithelial cell receptor protein tyosine kinase
- protein tyrosine kinase
- protein tyrosine kinase
- receptor protein tyrosine kinase regulated by p53 and E2F-1
- EC2.7.10.1
- ECK
|
| UniProt ID | P29317
|
| NCBI Gene ID | 1969 |
| GeneCard ID | GC01M016196 |
| SwissProt VARIANT ID | VAR_042122 |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000127, Ag001823
Alignment of all Isoforms |
| Mutation entries | Ag000547, Ag003526, Ag003527, Ag003528, Ag003529
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | SVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEG |
| Antigen sequence | SVTLDDLAPDTTYLVQVQALMQEGQGAGSKVHEFQTLSPEG |