| AgACC | Ag003486 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | CDK4 |
| Full Name | Cell division protein kinase 4 |
| Synonym | cell division kinase 4; cyclin-dependent kinase 4; malnoma cutaneous malignant 3; CMM3; CDK4; EC2.7.11.22; MGC14458; PSK-J3
another display format
- cell division kinase 4
- cyclin-dependent kinase 4
- malnoma cutaneous malignant 3
- CMM3
- CDK4
- EC2.7.11.22
- MGC14458
- PSK-J3
|
| UniProt ID | P11802
|
| NCBI Gene ID | 1019 |
| GeneCard ID | GC12M057743 |
| SwissProt VARIANT ID | VAR_006201 |
| Comment | Cutaneous malignant melanoma 3 (CMM3) - Defects in CDK4 are the cause of cutaneous malignant melanoma 3 (CMM3). Malignant melanoma is a malignant neoplasm of melanocytes, arising de novo or from a preexisting benign nevus, which occurs most often in the skin but also may involve other sites |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000072, Ag001788
Alignment of all Isoforms |
| Mutation entries | Ag000073, Ag003486, Ag003487, Ag003488, Ag003489
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | SRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGG |
| Antigen sequence | SRYEPVAEIGVGAYGTVYKAHDPHSGHFVALKSVRVPNGGG |