| AgACC | Ag003480 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | ACTN4 |
| Common Name | Alpha-actinin-4 |
| Full Name | Non-muscle alpha-actinin 4 |
| Synonym | F-actin cross-linking protein; actinin, alpha4; ACTN4; DKFZp686k23158; FSGS; FSGS1
another display format
- F-actin cross-linking protein
- actinin, alpha4
- ACTN4
- DKFZp686k23158
- FSGS
- FSGS1
|
| UniProt ID | O43707
|
| NCBI Gene ID | 81 |
| GeneCard ID | GC19P038647 |
| SwissProt VARIANT ID | VAR_010380 |
| Comment | Focal segmental glomerulosclerosis 1 (FSGS1) - Defects in ACTN4 are the cause of focal segmental glomerulosclerosis 1. FSGS1 is a common renal lesion characterized by increased urinary protein excretion (proteinuria) and decreasing kidney function (nephrotic syndrome). Renal insufficiency often progresses to end-stage renal disease (ESRD) (also known as end-stage renal failure), a highly morbid state requiring either dialysis therapy or kidney transplantation. FSGS1 is defined by the presence of segmental sclerosis in glomeruli, and is seen in all ethnic groups, although it is particularly common in individuals of African descent. FSGS1 occurs as an isolated primary condition or secondary to disorders as HIV infection, obesity, hypertension and diabetes. FSGS1 may also be inherited as a Mendelian trait |
| Annotation | This is a fragment sequence. |
| Mutation entries | Ag000057, Ag003478, Ag003479, Ag003480
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | DAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRIC |
| Antigen sequence | DAEDIVNTARPDEKAIMTYVPSFYHAFSGAQKAETAANRIC |