| AgACC | Ag003474 |
| Date | 19-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | KRAS |
| Common Name | K-ras |
| Full Name | GTPase Kras |
| Synonym | K-Ras 2; K-ras p21 protein; Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog; PR310 c-K-ras oncogene; c-K-ras2 protein; c-Kirsten-ras protein; cellular c-Ki-ras2 proto-oncogene; oncogene KRAS; tansforming protein p21; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog KRAS; C-K-RAS, K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; KI-RAS; KRAS1; KRAS2; Ki-Ras; NS3; RASK2; c-K-RAS; C-Ki-RAS
another display format
- K-Ras 2
- K-ras p21 protein
- Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog
- PR310 c-K-ras oncogene
- c-K-ras2 protein
- c-Kirsten-ras protein
- cellular c-Ki-ras2 proto-oncogene
- oncogene KRAS
- tansforming protein p21
- v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog
- v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog KRAS
- C-K-RAS, K-RAS2A
- K-RAS2B
- K-RAS4A
- K-RAS4B
- KI-RAS
- KRAS1
- KRAS2
- Ki-Ras
- NS3
- RASK2
- c-K-RAS
- C-Ki-RAS
|
| UniProt ID | P01116
|
| NCBI Gene ID | 3845 |
| GeneCard ID | GC12M025204 |
| SwissProt VARIANT ID | VAR_026110 |
| Comment | Cardiofaciocutaneous syndrome (CFC syndrome) - Defects in KRAS are a cause of cardiofaciocutaneous syndrome; also known as cardio-facio-cutaneous syndrome. CFC syndrome is characterized by a distinctive facial appearance, heart defects and mental retardation. Heart defects include pulmonic stenosis, atrial septal defects and hypertrophic cardiomyopathy. Some affected individuals present with ectodermal abnormalities such as sparse, friable hair, hyperkeratotic skin lesions and a generalized ichthyosis-like condition. Typical facial features are similar to Noonan syndrome. They include high forehead with bitemporal constriction, hypoplastic supraorbital ridges, downslanting palpebral fissures, a depressed nasal bridge, and posteriorly angulated ears with prominent helices. The inheritance of CFC syndrome is autosomal dominant |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000047, Ag000051
Alignment of all Isoforms |
| Mutation entries | Ag000048, Ag000049, Ag001315, Ag001316, Ag001317, Ag001318, Ag001320, Ag001321, Ag001322, Ag001323, Ag001324, Ag001325, Ag001326, Ag001328, Ag001329, Ag001330
... Display all entries
Ag001331, Ag001332, Ag001333, Ag001334, Ag001335, Ag001336, Ag001337, Ag001338, Ag001339, Ag001340, Ag001341, Ag001342, Ag001343, Ag001344, Ag001345, Ag001346, Ag001347, Ag001348, Ag001349, Ag001350, Ag001351, Ag001352, Ag001353, Ag001355, Ag001357, Ag001359, Ag001360, Ag001361, Ag001362, Ag001363, Ag001364, Ag001365, Ag003474, Ag003475, Ag003476
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | VGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLD |
| Antigen sequence | VGKSALTIQLIQNHFVDEYDRTIEDSYRKQVVIDGETCLLD |
|