| AgACC | Ag002084 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | ADAM17 |
| Full Name | ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) |
| Synonym | CD156B; CD156b; CSVP; EC 3.4.24.86; MGC71942; TACE; cSVP; A disintegrin and metalloproteinase domain 17; ADAM 17 precursor; ADAM metallopeptidase domain 17; ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme); CD156b antigen; Snake venom-like protease; TNF-alpha convertase; TNF-alpha converting enzyme; TNF-alpha-converting enzyme; a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme); tumor necrosis factor, alpha, converting enzyme
another display format
- CD156B
- CD156b
- CSVP
- EC 3.4.24.86
- MGC71942
- TACE
- cSVP
- A disintegrin and metalloproteinase domain 17
- ADAM 17 precursor
- ADAM metallopeptidase domain 17
- ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme)
- CD156b antigen
- Snake venom-like protease
- TNF-alpha convertase
- TNF-alpha converting enzyme
- TNF-alpha-converting enzyme
- a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme)
- tumor necrosis factor, alpha, converting enzyme
|
| UniProt ID | Q6P5T8
|
| NCBI Gene ID | 6868 |
| GeneCard ID | GC02M009580 |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000454, Ag000455, Ag002083, Ag002085
Alignment of all Isoforms |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Antigen sequence | MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLL
TFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRI
NTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEGKT |
|