| AgACC | Ag001951 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | MDM2 |
| Full Name | Mouse double minute 2 |
| Synonym | Double minute 2 protein, Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse), Oncoprotein Mdm2, Ubiquitin-protein ligase E3 Mdm2, mouse double minute 2 homolog, human homolog of; p53-binding protein; p53-binding protein Mdm2; EC 6.3.2.-; HDM2; HDMX; Hdm2; MGC71221; MDM2
another display format
- Double minute 2 protein, Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse), Oncoprotein Mdm2, Ubiquitin-protein ligase E3 Mdm2, mouse double minute 2 homolog, human homolog of
- p53-binding protein
- p53-binding protein Mdm2
- EC 6.3.2.-
- HDM2
- HDMX
- Hdm2
- MGC71221
- MDM2
|
| UniProt ID | Q8NDW0
|
| NCBI Gene ID | 4193 |
| GeneCard ID | GC12P068808 |
| Annotation | This is a full length sequence. |
| Isoforms | Ag000287, Ag000288, Ag000289, Ag000290, Ag000291, Ag000292, Ag000293, Ag000294, Ag000295, Ag000296, Ag001941, Ag001942, Ag001943, Ag001944, Ag001945, Ag001947, Ag001948, Ag001949, Ag001950, Ag001952, Ag001954, Ag001955, Ag001956, Ag001957, Ag001958, Ag001959, Ag001960, Ag001961, Ag001962, Ag001963
Alignment of all Isoforms |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference | | VLFYLGQYI | 53-61 | A2 |
12747748 |
| YTMKEVLFYL | 48-57 | A2 |
12747748 |
| Predicted HLA binders | |
| Antigen sequence | MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEK
QQHIVYCSNDCANLFPLVDLSIRELYISNYITLGI |
|