Antigen Record Ag000292

AgACCAg000292
Date11-02-2007
Last updated14-12-2016
Antigen NameMDM2
Full NameMouse double minute 2
SynonymDouble minute 2 protein, Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse), Oncoprotein Mdm2, Ubiquitin-protein ligase E3 Mdm2, mouse double minute 2 homolog, human homolog of; p53-binding protein; p53-binding protein Mdm2; EC 6.3.2.-; HDM2; HDMX; Hdm2; MGC71221; MDM2

another display format
  • Double minute 2 protein, Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse), Oncoprotein Mdm2, Ubiquitin-protein ligase E3 Mdm2, mouse double minute 2 homolog, human homolog of
  • p53-binding protein
  • p53-binding protein Mdm2
  • EC 6.3.2.-
  • HDM2
  • HDMX
  • Hdm2
  • MGC71221
  • MDM2
UniProt IDQ00987
NCBI Gene ID4193
GeneCard IDGC12P068808
CommentThis is a splice isoform.
AnnotationThis is a full length sequence.
IsoformsAg000287,  Ag000288,  Ag000289,  Ag000290,  Ag000291,  Ag000293,  Ag000294,  Ag000295,  Ag000296,  Ag001941,  Ag001942,  Ag001943,  Ag001944,  Ag001945,  Ag001947,  Ag001948,  Ag001949,  Ag001950,  Ag001951,  Ag001952,  Ag001954,  Ag001955,  Ag001956,  Ag001957,  Ag001958,  Ag001959,  Ag001960,  Ag001961,  Ag001962,  Ag001963

Alignment of all Isoforms
RNA/protein expression profileRNA and protein Expression profile
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMCNTNMSVPTDGAVTTSQIPASEQETLVRQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESS
LPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP