Antigen Record Ag001777

AgACCAg001777
Date04-08-2008
Last updated14-12-2016
Antigen NameKRAS
Common NameK-ras
Full NameGTPase Kras
SynonymK-Ras 2; K-ras p21 protein; Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog; PR310 c-K-ras oncogene; c-K-ras2 protein; c-Kirsten-ras protein; cellular c-Ki-ras2 proto-oncogene; oncogene KRAS; tansforming protein p21; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog KRAS; C-K-RAS, K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; KI-RAS; KRAS1; KRAS2; Ki-Ras; NS3; RASK2; c-K-RAS; C-Ki-RAS

another display format
  • K-Ras 2
  • K-ras p21 protein
  • Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog
  • PR310 c-K-ras oncogene
  • c-K-ras2 protein
  • c-Kirsten-ras protein
  • cellular c-Ki-ras2 proto-oncogene
  • oncogene KRAS
  • tansforming protein p21
  • v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog
  • v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog KRAS
  • C-K-RAS, K-RAS2A
  • K-RAS2B
  • K-RAS4A
  • K-RAS4B
  • KI-RAS
  • KRAS1
  • KRAS2
  • Ki-Ras
  • NS3
  • RASK2
  • c-K-RAS
  • C-Ki-RAS
UniProt IDQ14014
NCBI Gene ID3845
GeneCard IDGC12M025204
AnnotationThis is a fragment sequence.
IsoformsAg000047Ag000051

Alignment of all Isoforms
Mutation entriesAg000048Ag000049Ag001315Ag001316Ag001317Ag001318Ag001320Ag001321Ag001322Ag001323Ag001324Ag001325Ag001326Ag001328Ag001329Ag001330
... Display all entries


View mutation map
RNA/protein expression profileRNA and protein Expression profile
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceMTEYKLVVVGAGGVGKSALTIQLIDNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQ
YMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIP
FIQTSAKTRQ