Antigen Record Ag001697

AgACCAg001697
Date04-08-2008
Last updated14-12-2016
Antigen NameSTAT1
Full NameSignal transducer and activator of transcription 1, 91kDa
SynonymDKFZp686B04100; ISGF-3; STAT91; Signal transducer and activator of transcription 1-alpha/beta; Transcription factor ISGF-3 components p91/p84; signal transducer and activator of transcription 1; signal transducer and activator of transcription 1, 91kD; signal transducer and activator of transcription 1, 91kDa; signal transducer and activator of transcription-1; transcription factor ISGF-3

another display format
  • DKFZp686B04100
  • ISGF-3
  • STAT91
  • Signal transducer and activator of transcription 1-alpha/beta
  • Transcription factor ISGF-3 components p91/p84
  • signal transducer and activator of transcription 1
  • signal transducer and activator of transcription 1, 91kD
  • signal transducer and activator of transcription 1, 91kDa
  • signal transducer and activator of transcription-1
  • transcription factor ISGF-3
UniProt IDA5D905
NCBI Gene ID6772
GeneCard IDGC02M190964
AnnotationThis is a fragment sequence.
IsoformsAg000451,  Ag000452,  Ag002081,  Ag002082

Alignment of all Isoforms
Mutation entriesAg000562,  Ag004097,  Ag004098,  Ag004099

View mutation map
RNA/protein expression profileRNA and protein Expression profile
Predicted HLA binders
Allele:  predictions
Peptide length:   
Antigen sequenceDCREDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKS
LEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALI
NDELVEWKRRQQSACIGGRPLLSFL