| AgACC | Ag001697 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | STAT1 |
| Full Name | Signal transducer and activator of transcription 1, 91kDa |
| Synonym | DKFZp686B04100; ISGF-3; STAT91; Signal transducer and activator of transcription 1-alpha/beta; Transcription factor ISGF-3 components p91/p84; signal transducer and activator of transcription 1; signal transducer and activator of transcription 1, 91kD; signal transducer and activator of transcription 1, 91kDa; signal transducer and activator of transcription-1; transcription factor ISGF-3
another display format
- DKFZp686B04100
- ISGF-3
- STAT91
- Signal transducer and activator of transcription 1-alpha/beta
- Transcription factor ISGF-3 components p91/p84
- signal transducer and activator of transcription 1
- signal transducer and activator of transcription 1, 91kD
- signal transducer and activator of transcription 1, 91kDa
- signal transducer and activator of transcription-1
- transcription factor ISGF-3
|
| UniProt ID | A5D905
|
| NCBI Gene ID | 6772 |
| GeneCard ID | GC02M190964 |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000451, Ag000452, Ag002081, Ag002082
Alignment of all Isoforms |
| Mutation entries | Ag000562, Ag004097, Ag004098, Ag004099
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Antigen sequence | DCREDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKS
LEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALI
NDELVEWKRRQQSACIGGRPLLSFL |