| AgACC | Ag001580 |
| Date | 04-08-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | SSX2 |
| Common Name | SSX2 or HOM-MEL-40 |
| Full Name | Sarcoma, synovial, X-chromosome-related 2 |
| Synonym | Protein SSX2; synovial sarcoma, X breakpoint 2; synovial sarcoma, X brakpoint 2 isoform b; synovial sarcoma, X breakpoint 2B; HD21; HOM-MEL-40; MGC119055; MGC15364; MGC3884; SSX2
another display format
- Protein SSX2
- synovial sarcoma, X breakpoint 2
- synovial sarcoma, X brakpoint 2 isoform b
- synovial sarcoma, X breakpoint 2B
- HD21
- HOM-MEL-40
- MGC119055
- MGC15364
- MGC3884
- SSX2
|
| UniProt ID | Q8WWZ9
|
| NCBI Gene ID | 6757 |
| GeneCard ID | GC0XM052696 |
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000044, Ag000045
Alignment of all Isoforms |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference |
| RLQGISPKI | 9-17 | A*0201 |
12594572 |
| Predicted HLA binders | |
| Antigen sequence | ERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGKR |