| AgACC | Ag001228 |
| Date | 29-03-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | EGFR |
| Common Name | Epidermal growth factor receptor (EGFR) |
| Full Name | Epidermal growth factor receptor |
| Synonym | EC 2.7.10.1; ERBB; ERBB1; mENA; Epidermal growth factor receptor precursor; Receptor tyrosine-protein kinase ErbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; cell growth inhibiting protein 40; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v-erb-b) oncogene homolog); epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
another display format
- EC 2.7.10.1
- ERBB
- ERBB1
- mENA
- Epidermal growth factor receptor precursor
- Receptor tyrosine-protein kinase ErbB-1
- avian erythroblastic leukemia viral (v-erb-b) oncogene homolog
- cell growth inhibiting protein 40
- epidermal growth factor receptor
- epidermal growth factor receptor (avian erythroblastic leukemia viral (v-erb-b) oncogene homolog)
- epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
|
| UniProt ID | P00533
|
| NCBI Gene ID | 1956 |
| GeneCard ID | GC07P055019 |
| COSMIC ID | 13190
|
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000499, Ag000500, Ag000501, Ag000502, Ag002115, Ag002116, Ag002117, Ag002118, Ag002120
Alignment of all Isoforms |
| Mutation entries | Ag001132, Ag001133, Ag001134, Ag001135, Ag001136, Ag001137, Ag001138, Ag001139, Ag001140, Ag001141, Ag001142, Ag001143, Ag001144, Ag001145, Ag001146, Ag001147 ... Display all entries
Ag001148, Ag001149, Ag001150, Ag001151, Ag001152, Ag001153, Ag001154, Ag001155, Ag001156, Ag001157, Ag001158, Ag001159, Ag001160, Ag001161, Ag001162, Ag001163, Ag001164, Ag001165, Ag001166, Ag001167, Ag001168, Ag001169, Ag001170, Ag001171, Ag001172, Ag001173, Ag001174, Ag001175, Ag001176, Ag001177, Ag001178, Ag001179, Ag001180, Ag001181, Ag001182, Ag001183, Ag001184, Ag001185, Ag001186, Ag001187, Ag001188, Ag001189, Ag001190, Ag001191, Ag001192, Ag001193, Ag001194, Ag001195, Ag001196, Ag001197, Ag001198, Ag001199, Ag001200, Ag001201, Ag001202, Ag001203, Ag001204, Ag001205, Ag001206, Ag001207, Ag001208, Ag001209, Ag001210, Ag001211, Ag001212, Ag001213, Ag001214, Ag001215, Ag001216, Ag001217, Ag001218, Ag001219, Ag001220, Ag001221, Ag001222, Ag001223, Ag001224, Ag001225, Ag001226, Ag001227, Ag001228, Ag001229, Ag001230, Ag001231, Ag001232, Ag001233, Ag001234, Ag001235, Ag001236, Ag001237, Ag001238, Ag001239, Ag001240, Ag001241, Ag001242, Ag001243, Ag001244, Ag001245, Ag001246, Ag001247, Ag001248, Ag001249, Ag001250, Ag001251, Ag001252, Ag001253, Ag001254, Ag001255, Ag001256, Ag001257, Ag001258, Ag001259, Ag001260, Ag001261, Ag001262, Ag001263, Ag001264, Ag001265, Ag001266, Ag001267, Ag001268, Ag001269, Ag001270, Ag001271, Ag001272, Ag001273, Ag001274, Ag001275, Ag001276, Ag001277, Ag001278, Ag001279, Ag001280, Ag001281, Ag001282, Ag001283, Ag001284, Ag001285, Ag001286, Ag001287, Ag001288, Ag001289, Ag001290, Ag004131, Ag004132, Ag004133, Ag004134, Ag004135, Ag004136, Ag004137, Ag004138, Ag004139, Ag004140
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| T cell epitope | Epitope sequence | Position | HLA allele | Reference | | DYVREHKDNI | 29-38 | A24 |
15251169 |
| Predicted HLA binders | |
| Reference sequence | PHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQ |
| Antigen sequence | PHVCRLLGICLTSTVQLITQPMPFGCLLDYVREHKDNIGSQ |
|