| AgACC | Ag000569 |
| Date | 29-03-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | ZUBR1 |
| Common Name | E3 ubiquitin-protein ligase UBR4 |
| Full Name | Zinc finger, UBR1 type 1-fragment |
| Synonym | CDNA FLJ12260 fis; clone MAMMA1001551; ZUBR1 protein; ZUBR1 protein - Fragment; retinoblastoma-associated factor 600; retinoblastoma-associated factor 600-like protein; zinc finger, UBR1 type; FLJ41863; KIAA0462; KIAA1307; RBAF600; RP5-1126H10.1; p600; ZUBR1; E3 ubiquitin-protein ligase UBR4; 600 kDa retinoblastoma protein-associated factor; N-recognin-4; Retinoblastoma-associated; UBR4 factor of 600 kDa
another display format
- CDNA FLJ12260 fis
- clone MAMMA1001551
- ZUBR1 protein
- ZUBR1 protein - Fragment
- retinoblastoma-associated factor 600
- retinoblastoma-associated factor 600-like protein
- zinc finger, UBR1 type
- FLJ41863
- KIAA0462
- KIAA1307
- RBAF600
- RP5-1126H10.1
- p600
- ZUBR1
- E3 ubiquitin-protein ligase UBR4
- 600 kDa retinoblastoma protein-associated factor
- N-recognin-4
- Retinoblastoma-associated
- UBR4 factor of 600 kDa
|
| UniProt ID | Q5T4S7
|
| NCBI Gene ID | 23352 |
| GeneCard ID | GC01M019074 |
| COSMIC ID | 26012
|
| Annotation | This is a fragment sequence. |
| Mutation entries | Ag000268, Ag000569, Ag003772, Ag003773, Ag003774, Ag003775
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | ENSQVGEGVCAVLLGTLTPMATEMLANGDGTGFPELMVVMA |
| Antigen sequence | ENSQVGEGVCAVLLGTLTPMTTEMLANGDGTGFPELMVVMA |