| AgACC | Ag000561 |
| Date | 29-03-2008 |
| Last updated | 14-12-2016 |
| Antigen Name | RARA |
| Common Name | RAR alpha |
| Full Name | Retinoic acid receptor |
| Synonym | NuMA-RARA fusion; Retinoic acid receptor alpha; alpha polypeptide; nuclear mitotic apparatus protein-retinoic acid receptor alpha fusion protein; nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR; nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form; retinoic acid receptor, alpha; NR1B1; RAR; RAR-alpha
another display format
- NuMA-RARA fusion
- Retinoic acid receptor alpha
- alpha polypeptide
- nuclear mitotic apparatus protein-retinoic acid receptor alpha fusion protein
- nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR
- nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form
- retinoic acid receptor, alpha
- NR1B1
- RAR
- RAR-alpha
|
| UniProt ID | P10276
|
| NCBI Gene ID | 5914 |
| GeneCard ID | GC17P040309 |
| COSMIC ID | 22193
|
| Annotation | This is a fragment sequence. |
| Isoforms | Ag000378, Ag000379, Ag002034, Ag002035
Alignment of all Isoforms |
| Mutation entries | Ag000561
View mutation map |
| RNA/protein expression profile | RNA and protein Expression profile |
| Predicted HLA binders | |
| Reference sequence | CIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICT |
| Antigen sequence | CIIKTVEFAKQLPGFTTLTITDQITLLKAACLDILILRICT |